Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade

  • PX-TA1118-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €240.00.Current price is: €200.00.

100ug 17% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

Product name Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1118-50
Uniprot ID P29460
Source CAS 339308-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Briakinumab,ABT-874,J695,LDP-01,MLNM2201,IL12B,anti-IL12B
Reference PX-TA1118
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade

Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade: A Promising Antibody for Targeting IL12B

Introduction

Briakinumab Biosimilar, also known as Anti-IL12B mAb, is a research grade monoclonal antibody that has shown promising results in targeting IL12B. IL12B, also known as interleukin-12B, is a cytokine that plays a crucial role in the immune response and has been implicated in various diseases. Briakinumab Biosimilar has been developed as a potential therapeutic agent for these diseases by specifically targeting IL12B.

Structure of Briakinumab Biosimilar

Briakinumab Biosimilar is a monoclonal antibody, meaning it is produced from a single clone of immune cells. It is a fully humanized antibody, meaning it is derived from human cells and has a structure similar to endogenous antibodies. The antibody consists of two heavy chains and two light chains, each with a variable region that binds to IL12B and a constant region that mediates effector functions. The variable region is responsible for the specificity of Briakinumab Biosimilar towards IL12B, making it a highly specific and effective therapeutic agent.

Mechanism of Action

Briakinumab Biosimilar works by binding to IL12B and preventing its interaction with its receptor, IL12R. This inhibits the downstream signaling pathways that are activated by IL12B, leading to a decrease in the production of pro-inflammatory cytokines and an increase in anti-inflammatory cytokines. This results in a balanced immune response and can help in the treatment of various diseases where IL12B is overexpressed.

Applications of Briakinumab Biosimilar

Briakinumab Biosimilar has shown promising results in preclinical studies for various diseases, including psoriasis, inflammatory bowel disease, and multiple sclerosis. In psoriasis, IL12B has been found to be overexpressed, leading to an imbalance in the immune response and the development of skin lesions. Briakinumab Biosimilar has been shown to effectively target IL12B and improve symptoms in patients with psoriasis. Similarly, in inflammatory bowel disease, IL12B has been implicated in the pathogenesis, and Briakinumab Biosimilar has shown potential in reducing inflammation and improving symptoms in animal models. In multiple sclerosis, Briakinumab Biosimilar has been shown to decrease the production of pro-inflammatory cytokines and reduce disease severity in animal models.

Advantages of Briakinumab Biosimilar

One of the major advantages of Briakinumab Biosimilar is its high specificity towards IL12B. This reduces the risk of off-target effects and makes it a safer therapeutic option. Additionally, being a fully humanized antibody, it has a low risk of immunogenicity, making it suitable for long-term treatment. Its mechanism of action also allows for a more targeted and balanced immune response, reducing the risk of adverse effects associated with other immunosuppressive therapies.

Conclusion

Briakinumab Biosimilar, a research grade monoclonal antibody targeting IL12B, has shown promising results in preclinical studies for various diseases. Its high specificity, low immunogenicity, and targeted mechanism of action make it a promising therapeutic option for diseases where IL12B plays a crucial role. Further research and clinical trials are needed to fully evaluate the efficacy and safety of Briakinumab Biosimilar in the treatment of these diseases.

SDS-PAGE for Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

SDS-PAGE for Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade in ELISA Assay

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade in ELISA Assay

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Briakinumab Biosimilar - Anti-IL12B mAb - Research Grade

There are no reviews yet.

Be the first to review “Briakinumab Biosimilar – Anti-IL12B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products