Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-12 subunit alpha(IL12a)& Interleukin-12 subunit beta(Il12b)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P43431&P43432
Molecular weight:
40kDa & 43kDa

210.00

50ug + 210 loyalty points
Met1–Ala215 & Met1-Ser335 His Twin-Strep
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-12 subunit alpha(IL12a)& Interleukin-12 subunit beta(Il12b)

Product name Interleukin-12 subunit alpha(IL12a)& Interleukin-12 subunit beta(Il12b)
Uniprot ID P43431&P43432
Uniprot link https://www.uniprot.org/uniprot/P43432 & https://www.uniprot.org/uniprot/P43431
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGSHHHHHH MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal His Tag & C-terminal Twin-Strep Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala215 & Met1-Ser335
Protein Accession P43431&P43432
Spec:Entrez GeneID 16160 & 16159
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40;p3; p35; IL-12; Ll12a; Il-12a; IL-12p35
NCBI Reference P43431&P43432
Aliases /Synonyms IL-12A,IL-12 subunit p35 & IL-12B,IL-12 subunit p40
Reference PX-P4690
Note For research use only
Molecular Constructor
Met1–Ala215 & Met1-Ser335 His Twin-Strep
Product name Interleukin-12 subunit alpha(IL12a)& Interleukin-12 subunit beta(Il12b)
Uniprot ID P43431&P43432
Uniprot link https://www.uniprot.org/uniprot/P43432 & https://www.uniprot.org/uniprot/P43431
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGSHHHHHH MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal His Tag & C-terminal Twin-Strep Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala215 & Met1-Ser335
Protein Accession P43431&P43432
Spec:Entrez GeneID 16160 & 16159
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40;p3; p35; IL-12; Ll12a; Il-12a; IL-12p35
NCBI Reference P43431&P43432
Aliases /Synonyms IL-12A,IL-12 subunit p35 & IL-12B,IL-12 subunit p40
Reference PX-P4690
Note For research use only
Molecular Constructor
Met1–Ala215 & Met1-Ser335 His Twin-Strep

There are no reviews yet.

Be the first to review “Interleukin-12 subunit alpha(IL12a)& Interleukin-12 subunit beta(Il12b)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products