Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Interleukin-12 subunit beta(IL12B)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P29460
Molecular weight:
38.2kDa

210.00

50ug + 210 loyalty points
Met1–Ser328 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Interleukin-12 subunit beta(IL12B)

Product name Human Interleukin-12 subunit beta(IL12B)
Uniprot ID P29460
Uniprot link https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 38.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser328
Protein Accession P29460
Spec:Entrez GeneID 3593
Spec:NCBI Gene Aliases CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
NCBI Reference P29460
Aliases /Synonyms NKSF2
Reference PX-P4561
Note For research use only
Molecular Constructor
Met1–Ser328 His
Product name Human Interleukin-12 subunit beta(IL12B)
Uniprot ID P29460
Uniprot link https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 38.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser328
Protein Accession P29460
Spec:Entrez GeneID 3593
Spec:NCBI Gene Aliases CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
NCBI Reference P29460
Aliases /Synonyms NKSF2
Reference PX-P4561
Note For research use only
Molecular Constructor
Met1–Ser328 His

There are no reviews yet.

Be the first to review “Human Interleukin-12 subunit beta(IL12B)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products