Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bimekizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Bimekizumab ELISA Kit

Bimekizumab ELISA Kit

Product name Bimekizumab ELISA Kit
Uniprot ID Q16552 & Q96PD4
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX258
Note For research use only.
Sample type Plasma, Serum
Target Bimekizumab
Immunogen Bimekizumab

Introduction

Bimekizumab is a novel monoclonal antibody that has recently gained attention as a potential therapeutic agent for the treatment of various inflammatory diseases. It is a humanized IgG1 antibody that specifically targets interleukin-17A and interleukin-17F, two key cytokines involved in the pathogenesis of immune-mediated disorders. The development of a Bimekizumab ELISA Kit has enabled researchers to accurately measure the levels of this antibody in biological samples, providing valuable insights into its structure, activity, and potential applications.

Structure of Bimekizumab

Bimekizumab is a 143 kDa monoclonal antibody that consists of two identical heavy chains and two identical light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain two constant domains (CL and CL’) and one variable domain (VL). The variable domains of both heavy and light chains contribute to the antigen-binding site, which determines the specificity of the antibody.

The structure of Bimekizumab is similar to other humanized IgG1 antibodies, with a characteristic “Y” shape formed by the heavy and light chains. The constant domains of the heavy chains are responsible for effector functions, such as complement activation and antibody-dependent cellular cytotoxicity, while the variable domains confer antigen-binding specificity. Bimekizumab has a high affinity for interleukin-17A and interleukin-17F, making it a potent inhibitor of their activity.

Activity of Bimekizumab

Bimekizumab exerts its therapeutic effects by selectively binding to interleukin-17A and interleukin-17F, thereby inhibiting their interaction with their respective receptors. These cytokines play a crucial role in the pathogenesis of various inflammatory diseases, such as psoriasis, psoriatic arthritis, and ankylosing spondylitis. By blocking their activity, Bimekizumab helps to reduce inflammation and associated symptoms, such as skin lesions, joint pain, and stiffness.

The activity of Bimekizumab has been demonstrated in preclinical and clinical studies. In a phase IIb trial, Bimekizumab showed significant efficacy in treating moderate to severe plaque psoriasis, with a rapid onset of action and sustained response over 48 weeks. It also demonstrated promising results in patients with psoriatic arthritis, with a significant improvement in joint symptoms and skin manifestations. These findings highlight the potential of Bimekizumab as a therapeutic agent for various inflammatory diseases.

Application of Bimekizumab ELISA Kit

The development of a Bimekizumab ELISA Kit has enabled researchers to accurately measure the levels of this antibody in biological samples, such as serum, plasma, and tissue homogenates. This quantitative assay utilizes the sandwich enzyme-linked immunosorbent assay (ELISA) technique, in which Bimekizumab is captured by a specific antibody coated on the microplate and then detected by a second antibody conjugated with an enzyme.

The Bimekizumab ELISA Kit has several potential applications in the field of drug development and clinical research. It can be used to monitor the pharmacokinetics of Bimekizumab in patients receiving treatment, helping to optimize dosing regimens and assess drug efficacy. It can also be used to measure the levels of Bimekizumab in different biological fluids, providing valuable insights into its distribution and elimination from the body.

Conclusion

Bimekizumab is a promising therapeutic agent for the treatment of various inflammatory diseases, and the development of a Bimekizumab ELISA Kit has facilitated its characterization and evaluation. This kit allows for accurate measurement of Bimekizumab levels in biological samples, providing valuable information about its structure, activity, and potential applications. Further research and clinical trials are needed to fully understand the potential of Bimekizumab in the management of immune-mediated disorders.

Bimekizumab ELISA Kit

There are no reviews yet.

Be the first to review “Bimekizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products