Brand: ProteoGenix

Bevacizumab Biosimilar – Anti-VEGF mAb – Research Grade

PX-TA1006-100UG
Validated ELISA FC

Isotype:: IgG1

Original price was: €154.00.Current price is: €120.00.

100ug 22% OFF + 120 loyalty points

Size Size

50ug Original price was: €115.00.Current price is: €84.00.
100ug Original price was: €154.00.Current price is: €120.00.
1MG Original price was: €252.00.Current price is: €200.00.
10mg Original price was: €1,260.00.Current price is: €1,000.00.
25mg Original price was: €2,814.00.Current price is: €2,100.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Bevacizumab Biosimilar - Anti-VEGF mAb

Bevacizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Bevacizumab Biosimilar - Anti-VEGF mAb - Research Grade

Product name	Bevacizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB00112
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	149kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Bevacizumab,Bevacizumab,VEGF,anti-VEGF
Reference	PX-TA1006
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1

Product name	Bevacizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB00112
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	149kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Bevacizumab,Bevacizumab,VEGF,anti-VEGF
Reference	PX-TA1006
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1

Product name	PX-TA1006-50
Uniprot ID	P15692
Source	DrugBank DB00112
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	149kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Bevacizumab,Bevacizumab,VEGF,anti-VEGF
Reference	PX-TA1006
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1

Product name	Bevacizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB00112
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	149kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Bevacizumab,Bevacizumab,VEGF,anti-VEGF
Reference	PX-TA1006
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1
Clonality	Monoclonal Antibody

Product name	Bevacizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB00112
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	149kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Bevacizumab,Bevacizumab,VEGF,anti-VEGF
Reference	PX-TA1006
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1
Clonality	Monoclonal Antibody

General information about Bevacizumab

Bevacizumab, is classified as a monoclonal antibody and/or anti-angiogenesis drug. It is a comparatively new type of cancer therapy. Antibodies are an essential part of the immune system. The body creates antibodies in response to an antigen entering the body. These antibodies attach themselves to the antigen, to mark it for destruction by the body’s immune system. Bevacizumab allows human body to target specific cells, causing less toxicity to healthy cells. It works by interfering with the process of angiogenesis by targeting and inhibiting human vascular endothelial growth factor (VEGF). VEGF is a cytokine (a small protein released by cells that have specific effects on the behavior of cells) which when it interacts with its receptors in the cell leads to new blood vessel formation or angiogenesis. This product is for research use only.

SDS-PAGE for Bevacizumab Biosimilar - Anti-VEGF mAb

Bevacizumab Biosimilar - Anti-VEGF mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bevacizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Bevacizumab Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1006) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 97.73M.