Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bevacizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Bevacizumab ELISA Kit

Bevacizumab ELISA Kit

Product name Bevacizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°C)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX187
Note For research use only.
Sample type Plasma, Serum
Target Bevacizumab
Immunogen Bevacizumab

Introduction to Bevacizumab ELISA Kit

Bevacizumab is a monoclonal antibody that targets the vascular endothelial growth factor (VEGF), a protein involved in the formation of new blood vessels. This antibody is used as a therapeutic agent in the treatment of various cancers, including colorectal, lung, and breast cancer. The Bevacizumab ELISA kit is a highly sensitive and specific assay designed for the quantitative measurement of Bevacizumab levels in biological samples.

Structure of Bevacizumab

Bevacizumab is a recombinant humanized IgG1 monoclonal antibody with a molecular weight of approximately 149 kDa. It is composed of two heavy chains and two light chains, each containing a variable and a constant region. The variable region of Bevacizumab is responsible for binding to the VEGF protein, while the constant region is involved in effector functions such as complement activation and binding to Fc receptors.

Activity of Bevacizumab

Bevacizumab exerts its activity by binding to VEGF and preventing its interaction with its receptors on the surface of endothelial cells. This inhibits the signaling pathway that promotes the growth of new blood vessels, known as angiogenesis. By blocking angiogenesis, Bevacizumab prevents the supply of nutrients and oxygen to the tumor, thereby inhibiting its growth and spread.

Additionally, Bevacizumab also enhances the efficacy of chemotherapy by increasing the delivery of chemotherapeutic agents to the tumor site. This is achieved by normalizing the abnormal and leaky blood vessels present in tumors, allowing for better penetration of drugs into the tumor tissue.

Application of Bevacizumab ELISA Kit

The Bevacizumab ELISA kit is a valuable tool for monitoring the levels of Bevacizumab in biological samples. It is commonly used in clinical trials to assess the pharmacokinetics of Bevacizumab and to determine the optimal dosage for patients. The kit can also be used to measure the levels of Bevacizumab in patient serum or plasma to monitor treatment response and assess the need for dose adjustments.

Furthermore, the Bevacizumab ELISA kit is also used in research studies to investigate the pharmacodynamics of Bevacizumab, such as its effect on VEGF levels and angiogenesis. It can also be used to evaluate the presence of anti-drug antibodies, which may affect the efficacy of Bevacizumab treatment.

Conclusion

The Bevacizumab ELISA kit is a highly sensitive and specific assay that plays a crucial role in the development and monitoring of Bevacizumab therapy. Its ability to accurately measure Bevacizumab levels in biological samples makes it an essential tool for clinical and research purposes. With the increasing use of Bevacizumab in cancer treatment, the Bevacizumab ELISA kit will continue to be a valuable asset in the fight against cancer.

Keywords:

Bevacizumab, ELISA kit, monoclonal antibody, VEGF, therapeutic target, angiogenesis, pharmacokinetics, pharmacodynamics, anti-drug antibodies, cancer treatment.

Bevacizumab ELISA Kit

  • Hammer, M.; Herth, J.; Herbster, L.; Böhmann, M.B.; Muuss, M.; Khoramnia, R.; Scheuerle, A.; Mier, W.; Wohlfart, S.; Auffarth, G.U.; et al. In Vitro Physicochemical and Pharmacokinetic Properties of Bevacizumab Dissolved in Silicone Oils Compared to Hydrogel-Substitutes and Porcine Vitreous Bodies. Gels 2024, 10, 501. https://doi.org/10.3390/gels10080501
  • Wohlfart S, Herth J, Böhmann MB, et al. Exposure to silicone oil endotamponades induces VEGF antibody aggregation and loss of functionality. Invest Ophthalmol Vis Sci. 2024;65(13):56. https://doi.org/10.1167/iovs.65.13.56

There are no reviews yet.

Be the first to review “Bevacizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products