Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2045-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade is a novel biosimilar antibody that targets the therapeutic protein BETVIA. This monoclonal antibody (mAb) has been specifically designed to mimic the structure and function of the original BETVIA-targeting antibody, making it a promising candidate for treating various diseases and disorders.

Structure of Atisnolerbart Biosimilar

Atisnolerbart Biosimilar is a recombinant, fully humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the therapeutic target, BETVIA, while the constant regions provide stability and effector functions.

Activity of Atisnolerbart Biosimilar

Atisnolerbart Biosimilar exerts its activity by binding to BETVIA with high specificity and affinity. This binding prevents BETVIA from interacting with its cellular receptors, thereby inhibiting its biological activity. As a result, the downstream signaling pathways and cellular processes regulated by BETVIA are also inhibited.

Application of Atisnolerbart Biosimilar

Atisnolerbart Biosimilar has potential applications in various therapeutic areas. Its primary use is in the treatment of diseases and disorders that are associated with overexpression or dysregulation of BETVIA. These include inflammatory conditions, autoimmune diseases, and certain types of cancer.

Inflammatory Conditions

BETVIA is known to play a crucial role in the development and progression of inflammatory conditions such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. By inhibiting BETVIA, Atisnolerbart Biosimilar can reduce inflammation and alleviate symptoms associated with these conditions.

Autoimmune Diseases

Autoimmune diseases, such as multiple sclerosis and lupus, are characterized by an overactive immune response against the body’s own tissues. BETVIA has been implicated in the pathogenesis of these diseases, and Atisnolerbart Biosimilar can potentially modulate the immune response by targeting BETVIA.

Cancer

BETVIA is also involved in the growth and survival of certain types of cancer cells. By blocking BETVIA, Atisnolerbart Biosimilar can inhibit the proliferation and survival of these cancer cells, making it a potential therapeutic option for cancer treatment.

Research Grade

Atisnolerbart Biosimilar is currently available in a research-grade form, which is intended for use in preclinical and clinical research studies. This grade of the antibody is produced using high-quality, state-of-the-art technology, ensuring consistency and purity for reliable and reproducible results.

Advantages of Atisnolerbart Biosimilar

Compared to the original BETVIA-targeting antibody, Atisnolerbart Biosimilar offers several advantages. As a biosimilar, it has a similar structure and function to the original antibody, making it highly specific and effective. Additionally, being a fully humanized antibody, it has a lower risk of immunogenicity and can be used in a wider range of patients.

Conclusion

Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade is a promising antibody with potential applications in various therapeutic areas. Its specific structure and activity make it a valuable tool for research studies, and its potential to target BETVIA in diseases and disorders makes it a promising candidate for future clinical use. Its availability in a research-grade form allows for further exploration of its therapeutic potential and paves the way for its development as a novel treatment option.

SDS-PAGE for Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products