Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cergutuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Cergutuzumab ELISA Kit

Cergutuzumab ELISA Kit

Product name Cergutuzumab ELISA Kit
Uniprot ID P06731
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX153
Note For research use only.
Sample type Plasma, Serum
Target Cergutuzumab
Immunogen Cergutuzumab

Introduction

Cergutuzumab is a monoclonal antibody that has shown promising results in the treatment of various types of cancer. It specifically targets the glycoprotein Nectin-4, which is overexpressed in many solid tumors, making it a potential therapeutic target. The Cergutuzumab ELISA Kit is a reliable and efficient tool for the detection and quantification of this antibody in biological samples.

Structure of Cergutuzumab

Cergutuzumab is a fully humanized IgG1 monoclonal antibody, meaning it is derived from human cells and has a structure similar to natural human antibodies. It consists of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the Nectin-4 protein, while the constant regions determine the antibody’s effector functions.

Activity of Cergutuzumab

Cergutuzumab works by binding to the Nectin-4 protein on the surface of cancer cells. This binding inhibits the growth and survival of cancer cells by blocking the interaction between Nectin-4 and its ligand, preventing the activation of signaling pathways that promote tumor growth. Additionally, Cergutuzumab can also activate the immune system to target and destroy cancer cells through antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) mechanisms.

Application of Cergutuzumab ELISA Kit

The Cergutuzumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Cergutuzumab in various biological samples, such as serum, plasma, and cell culture supernatants. This kit utilizes a sandwich ELISA method, where the antibody is captured by a specific Nectin-4 antigen-coated plate and then detected by a secondary antibody labeled with an enzyme. The amount of Cergutuzumab present in the sample is directly proportional to the color intensity, which can be measured using a spectrophotometer.

Advantages of Cergutuzumab ELISA Kit

– High sensitivity: The Cergutuzumab ELISA Kit can detect Cergutuzumab at very low concentrations, making it suitable for monitoring the levels of this antibody in patients undergoing treatment.

– Specificity: This kit only detects Cergutuzumab and does not cross-react with other antibodies, ensuring accurate and reliable results.

– Easy to use: The ELISA procedure is simple and can be performed in any laboratory with basic equipment, making it a convenient tool for researchers and clinicians.

– Cost-effective: The Cergutuzumab ELISA Kit is cost-effective compared to other methods of antibody detection, such as Western blotting or flow cytometry.

Clinical Applications

The Cergutuzumab ELISA Kit has been used in various clinical studies to evaluate the levels of Cergutuzumab in patients with different types of cancer, including breast, lung, and bladder cancer. It has been shown to be a useful tool for monitoring the response to treatment and predicting patient outcomes. Additionally, this kit has also been used in preclinical studies to assess the pharmacokinetics and pharmacodynamics of Cergutuzumab and to determine the optimal dosage for treatment.

Conclusion

In conclusion, the Cergutuzumab ELISA Kit is a valuable tool for the detection and quantification of Cergutuzumab in biological samples. Its high sensitivity, specificity, and ease of use make it a preferred method for researchers and clinicians studying the efficacy of this promising antibody in cancer treatment. With ongoing clinical trials and potential FDA approval, the Cergutuzumab ELISA Kit will continue to play a crucial role in the development and use of this therapeutic antibody.

Cergutuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Cergutuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products