Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acimtamig Biosimilar – Anti-CD30L receptor mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG VH-V-kappa-VH'-V-lambda homodimer

Original price was: €242.00.Current price is: €200.00.

100ug 17% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade

Product name Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody
Product name Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody
Product name PX-TA1981-50
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody

Introduction to Acimtamig Biosimilar – Anti-CD30L receptor mAb

Acimtamig Biosimilar is a research grade monoclonal antibody (mAb) that specifically targets the CD30L receptor. This biosimilar is designed to mimic the structure and function of the original anti-CD30L receptor mAb, with the goal of providing a more cost-effective and accessible option for researchers studying this therapeutic target. In this article, we will explore the structure, activity, and potential applications of Acimtamig Biosimilar in the field of antibody research.

Structure of Acimtamig Biosimilar

Acimtamig Biosimilar is a recombinant, humanized monoclonal antibody that is produced using advanced biotechnology techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL’) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the CD30L receptor.

Activity of Acimtamig Biosimilar

The primary function of Acimtamig Biosimilar is to block the interaction between the CD30L receptor and its ligand, CD30. This interaction is known to play a crucial role in the development and progression of various diseases, including cancer and autoimmune disorders. By binding to the CD30L receptor, Acimtamig Biosimilar prevents the activation of downstream signaling pathways, thereby inhibiting the growth and survival of diseased cells.

In addition to its therapeutic activity, Acimtamig Biosimilar also exhibits effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These effector functions allow the antibody to recruit and activate immune cells, such as natural killer cells and macrophages, to directly attack and eliminate targeted cells.

Title: Applications of Acimtamig Biosimilar

Acimtamig Biosimilar has potential applications in a wide range of research areas, including oncology, immunology, and drug development. In oncology, it can be used to study the role of the CD30L receptor in the development and progression of various cancers, such as Hodgkin’s lymphoma and anaplastic large cell lymphoma. It can also be used to evaluate the efficacy of Acimtamig Biosimilar as a potential therapeutic agent for these cancers.

In immunology, Acimtamig Biosimilar can be used to investigate the role of the CD30L receptor in autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. It can also be used to study the mechanism of action of other CD30L receptor-targeting therapies and to develop new treatment strategies.

Furthermore, Acimtamig Biosimilar can be used in drug development to screen and select potential therapeutic candidates that target the CD30L receptor. Its use in preclinical studies can provide valuable insights into the safety and efficacy of these candidates, ultimately aiding in the development of new and improved treatments for various diseases.

Conclusion

In summary, Acimtamig Biosimilar is a research grade monoclonal antibody that specifically targets the CD30L receptor. Its structure mimics that of the original anti-CD30L receptor mAb, and it exhibits both therapeutic and effector functions. With its potential applications in oncology, immunology, and drug development, Acimtamig Biosimilar offers a valuable tool for researchers studying the CD30L receptor and its role in disease.

SDS-PAGE for Research Grade Acimtamig

SDS-PAGE for Research Grade Acimtamig

Research Grade Acimtamig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade

There are no reviews yet.

Be the first to review “Acimtamig Biosimilar – Anti-CD30L receptor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products