Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acazicolcept Biosimilar – Anti-CD28 fusion protein – Research Grade

  • PX-TA1999-50
  • Validated ELISA
Uniprot ID:
P10747 & Q9Y6W8

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade

Product name Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)
Product name Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA1999-50
Uniprot ID P10747 & Q9Y6W8
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28, CD278, ICOS, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule, AILIM
Reference PX-TA1999
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [ICOSLG N-terminal fragment (1-122)]2 - IGHG1 Fc (Fragment constant)

The Structure of Acazicolcept Biosimilar – Anti-CD28 Fusion Protein

Acazicolcept Biosimilar is a novel fusion protein that has been developed as a biosimilar of the anti-CD28 antibody. The structure of this fusion protein is composed of two distinct domains: the anti-CD28 antibody domain and the therapeutic target domain. The anti-CD28 antibody domain is derived from a monoclonal antibody that specifically binds to the CD28 receptor on T cells. This domain is responsible for the binding and activation of the CD28 receptor. The therapeutic target domain is a fusion of the CD28 receptor and a specific therapeutic protein, which allows for targeted delivery of the therapeutic protein to the CD28 receptor.

The Activity of Acazicolcept Biosimilar

The main activity of Acazicolcept Biosimilar is to target and bind to the CD28 receptor on T cells. This binding leads to the activation of the CD28 receptor, which in turn activates T cells. The activation of T cells plays a crucial role in the immune response, as it leads to the proliferation and differentiation of T cells, as well as the production of cytokines. Additionally, the fusion of the CD28 receptor with a therapeutic protein allows for the targeted delivery of the therapeutic protein to the CD28 receptor, enhancing its activity.

The Application of Acazicolcept Biosimilar

Acazicolcept Biosimilar has been developed for research purposes and is not yet approved for clinical use. However, it has the potential to be used as a therapeutic agent in the treatment of various diseases, including autoimmune disorders, cancer, and infectious diseases. The targeted delivery of the therapeutic protein to the CD28 receptor allows for a more specific and effective treatment, with fewer side effects.

Autoimmune Disorders

One potential application of Acazicolcept Biosimilar is in the treatment of autoimmune disorders. The CD28 receptor is known to play a critical role in the activation and regulation of T cells, which are involved in the pathogenesis of autoimmune diseases. By targeting and activating the CD28 receptor, Acazicolcept Biosimilar can modulate the immune response and potentially treat autoimmune disorders such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus.

Cancer

Another potential application of Acazicolcept Biosimilar is in the treatment of cancer. The CD28 receptor is expressed on various types of cancer cells, and its activation has been linked to tumor growth and progression. By targeting and activating the CD28 receptor on cancer cells, Acazicolcept Biosimilar can potentially inhibit tumor growth and enhance the immune response against cancer cells. This could be especially beneficial in combination with other cancer therapies, such as chemotherapy and immunotherapy.

Infectious Diseases

Acazicolcept Biosimilar may also have applications in the treatment of infectious diseases. The CD28 receptor is involved in the activation of T cells, which play a crucial role in the immune response against pathogens. By targeting and activating the CD28 receptor, Acazicolcept Biosimilar can enhance the immune response and potentially aid in the treatment of infectious diseases, such as viral infections and bacterial infections.

Conclusion

In summary, Acazicolcept Biosimilar is a novel fusion protein that combines the anti-CD28 antibody with a therapeutic protein. Its structure allows for targeted delivery and activation of the CD28 receptor, leading to the activation of T cells and potential therapeutic benefits in autoimmune disorders, cancer, and infectious diseases. Further research and clinical trials are needed to fully explore the potential of Acazicolcept Biosimilar as a therapeutic agent.

Research Grade Acazicolcept binds to Recombinant Mouse CD28 Protein, N-His-SUMO in ELISA Assay

Research Grade Acazicolcept binds to Recombinant Mouse CD28 Protein, N-His-SUMO in ELISA Assay

Recombinant Mouse CD28 Protein, N-His-SUMO(cat. No.ARO-P11085) at 0.5µg/mL (100µL/well) can bind Research Grade Acazicolcept in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Acazicolcept

SDS-PAGE for Research Grade Acazicolcept

Research Grade Acazicolcept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Acazicolcept Biosimilar - Anti-CD28 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Acazicolcept Biosimilar – Anti-CD28 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products