Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD80 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P33681
Molecular weight:
45kDa

209.00

100ug + 209 loyalty points
Met1~Asn242 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD80 Recombinant Protein

Product name CD80 Recombinant Protein
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asn242
Aliases /Synonyms CD28LG, CD28LG1, LAB7
Reference PX-P4090
Note For research use only
Background information Array
Molecular Constructor
Met1~Asn242 His

General information on CD80 Recombinant Protein:

Cluster of Differentiation 80, also known as B7-1, is a member of the cell surface immunoglobulin superfamily. It is expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. CD80 plays a fundamental but different role in the activation of T cells. B7-1 / CD80 and B7-2 / CD86 and its CD28 and CTLA4 receptors constitute one of the main co-stimulatory pathways that regulate the response of T and B cells. CD80 is mainly expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. Although CTLA-4 and CD28 can bind to the same ligand, CTLA-4 binds B7-1 and B7-2 with an affinity 20-100 times greater than CD28 and participates in the negative regulation of immune responses. Therefore, CD80 is considered a promising therapeutic target for autoimmune diseases and various types of cancer.

There are no reviews yet.

Be the first to review “CD80 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products