Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rinvecalinase Alfa Biosimilar – Kallikrein-1 – Research Grade

Uniprot ID:
P06870

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rinvecalinase Alfa Biosimilar - Kallikrein-1 - Research Grade

Product name Rinvecalinase Alfa Biosimilar - Kallikrein-1 - Research Grade
Uniprot ID P06870
Source CAS: 2419877-37-3
Expression system XtenCHO
Raw Antigen Sequence MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Kallikrein-1, Kidney/pancreas/salivary gland kallikrein, Tissue kallikrein, KLK1
Reference PX-TA1993
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human kallikrein-1/KLK1 mature form
Product name Rinvecalinase Alfa Biosimilar - Kallikrein-1 - Research Grade
Uniprot ID P06870
Source CAS: 2419877-37-3
Expression system XtenCHO
Raw Antigen Sequence MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Kallikrein-1, Kidney/pancreas/salivary gland kallikrein, Tissue kallikrein, KLK1
Reference PX-TA1993
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human kallikrein-1/KLK1 mature form
Product name PX-TA1993-50
Uniprot ID P06870
Source CAS: 2419877-37-3
Expression system XtenCHO
Raw Antigen Sequence MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Kallikrein-1, Kidney/pancreas/salivary gland kallikrein, Tissue kallikrein, KLK1
Reference PX-TA1993
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human kallikrein-1/KLK1 mature form

The Structure of Rinvecalinase Alfa Biosimilar

Rinvecalinase Alfa Biosimilar, also known as Kallikrein-1, is a biosimilar antibody that is being developed for therapeutic use. It is a recombinant protein that is derived from the naturally occurring human enzyme, Kallikrein-1. The structure of Rinvecalinase Alfa Biosimilar is similar to that of Kallikrein-1, with a molecular weight of approximately 28 kDa and a primary structure consisting of 247 amino acids.

The protein is composed of two domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker region. The N-terminal domain is responsible for the catalytic activity of the enzyme, while the C-terminal domain is involved in substrate recognition and binding. The overall structure of Rinvecalinase Alfa Biosimilar is highly stable and well-folded, allowing it to maintain its biological activity.

The Activity of Rinvecalinase Alfa Biosimilar

Rinvecalinase Alfa Biosimilar is a serine protease, meaning it catalyzes the hydrolysis of peptide bonds using a serine residue in its active site. This enzyme is primarily involved in the regulation of the kinin-kallikrein system, which plays a crucial role in inflammation, blood pressure regulation, and tissue repair. Specifically, Rinvecalinase Alfa Biosimilar cleaves kininogen, a precursor protein, into smaller peptides called kinins, which have various physiological effects.

Rinvecalinase Alfa Biosimilar has been shown to have a high specificity for kininogen, with minimal activity towards other proteins. This specificity is important in maintaining the balance of the kinin-kallikrein system and preventing any unwanted side effects. Additionally, the enzyme has a high catalytic efficiency, meaning it can rapidly cleave kininogen into kinins, further contributing to its therapeutic potential.

The Application of Rinvecalinase Alfa Biosimilar

Due to its role in the kinin-kallikrein system, Rinvecalinase Alfa Biosimilar has potential therapeutic applications in various diseases. One of the main areas of interest is in the treatment of inflammatory diseases, such as rheumatoid arthritis and asthma. By inhibiting the activity of Rinvecalinase Alfa Biosimilar, the production of kinins can be reduced, leading to a decrease in inflammation and associated symptoms.

Another potential application of Rinvecalinase Alfa Biosimilar is in the treatment of cardiovascular diseases. The kinin-kallikrein system has been linked to the regulation of blood pressure, and dysregulation of this system has been observed in conditions such as hypertension. By targeting Rinvecalinase Alfa Biosimilar, it may be possible to modulate the levels of kinins and regulate blood pressure.

Rinvecalinase Alfa Biosimilar may also have a role in tissue repair and wound healing. Kinins have been shown to promote angiogenesis, the formation of new blood vessels, which is essential for tissue repair. By increasing the levels of kinins through the inhibition of Rinvecalinase Alfa Biosimilar, tissue repair may be accelerated.

The Future of Rinvecalinase Alfa Biosimilar

Rinvecalinase Alfa Biosimilar is currently in the research stage, with preclinical studies being conducted to further understand its structure and activity. However, with its potential therapeutic applications in various diseases, it has the potential to become a valuable treatment option in the future. Further studies and clinical trials will be necessary to fully evaluate its safety and efficacy in humans.

In conclusion, Rinvecalinase Alfa Biosimilar, also known as Kallikrein-1, is a biosimilar antibody with a similar structure and activity to the naturally occurring human enzyme. Its specificity and catalytic efficiency make it a promising therapeutic target for inflammatory diseases, cardiovascular diseases, and tissue

Rinvecalinase Alfa Biosimilar - Kallikrein-1 - Research Grade

There are no reviews yet.

Be the first to review “Rinvecalinase Alfa Biosimilar – Kallikrein-1 – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products