Zebra fish MCM5Nter Recombinant Protein

Reference:
Product nameZebra fish MCM5Nter Recombinant Protein
Uniprot IDQ7ZTS7
Uniprot linkhttp://www.uniprot.org/uniprot/Q7ZTS7
Origin speciesZebra fish
Expression systemProcaryotic expression
SequenceMGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTIWEFALMSGFDDPGVYYSDSFGGGESVGDEGVVKRSQIK KKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTR PRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYA LPRKCNTEQAGRVKCPVDQLGCFGG
Molecular weight29,37 kDa
Protein delivered with Tag?Yes
Purity estimated80%
BufferPBS pH6-8 containing Urea 6M and Imidazole 10mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAH44460.1
Spec:SwissProtIDQ7ZTS7
NCBI ReferenceAAH44460.1
Aliases /SynonymsMCM5Nter, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae)
ReferencePX-P1125
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Zebra fish MCM5Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.







    X