Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Zebra fish MCM5Nter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Zebra fish
Uniprot ID:
Q7ZTS7
Molecular weight:
29,37 kDa

€210.00

50ug + 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Zebra fish MCM5Nter Recombinant Protein

Zebra fish MCM5Nter Recombinant Protein

Product name Zebra fish MCM5Nter Recombinant Protein
Uniprot ID Q7ZTS7
Uniprot link http://www.uniprot.org/uniprot/Q7ZTS7
Origin species Zebra fish
Expression system Prokaryotic expression
Sequence MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTIWEFALMSGFDDPGVYYSDSFGGGESVGDEGVVKRSQIK KKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTR PRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYA LPRKCNTEQAGRVKCPVDQLGCFGG
Molecular weight 29,37 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS pH6-8 containing Urea 6M and Imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH44460.1
Spec:SwissProtID Q7ZTS7
NCBI Reference AAH44460.1
Aliases /Synonyms MCM5Nter, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae)
Reference PX-P1125
Note For research use only
Molecular Constructor
Partial Yes
Product name Zebra fish MCM5Nter Recombinant Protein
Uniprot ID Q7ZTS7
Uniprot link http://www.uniprot.org/uniprot/Q7ZTS7
Origin species Zebra fish
Expression system Prokaryotic expression
Sequence MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTIWEFALMSGFDDPGVYYSDSFGGGESVGDEGVVKRSQIK KKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTR PRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYA LPRKCNTEQAGRVKCPVDQLGCFGG
Molecular weight 29,37 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS pH6-8 containing Urea 6M and Imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH44460.1
Spec:SwissProtID Q7ZTS7
NCBI Reference AAH44460.1
Aliases /Synonyms MCM5Nter, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae)
Reference PX-P1125
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Zebra fish MCM5Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products