Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb – Research Grade

  • PX-TA1757-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
Ig(G4-kappa_G4-lambda)

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade

Product name Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody
Product name Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody
Product name PX-TA1757-50
Uniprot ID Q04609 & P07766
Source CAS: 2411871-58-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Voxalatamab,JNJ-63898081, JNJ-8081,PSMA & CD3e,anti-PSMA & CD3e
Reference PX-TA1757
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig(G4-kappa_G4-lambda)
Clonality Monoclonal Antibody

Introduction

Voxalatamab Biosimilar, also known as Anti-PSMA & CD3e mAb, is a research grade monoclonal antibody that has shown promising results in the treatment of various types of cancer. This innovative antibody targets two specific proteins, PSMA and CD3e, which are involved in cancer cell growth and survival. In this article, we will explore the structure, activity, and potential applications of Voxalatamab Biosimilar.

Structure of Voxalatamab Biosimilar

Voxalatamab Biosimilar is a chimeric monoclonal antibody, meaning it is a combination of both human and mouse components. It is composed of two parts – the constant region, which is derived from human antibodies, and the variable region, which is derived from mouse antibodies. This unique structure allows Voxalatamab Biosimilar to bind to both human and mouse cells, making it a highly effective therapeutic agent.

Activity of Voxalatamab Biosimilar

The main target of Voxalatamab Biosimilar is prostate-specific membrane antigen (PSMA), a protein that is overexpressed in prostate cancer cells. PSMA is involved in the growth and survival of cancer cells, making it an ideal therapeutic target. By binding to PSMA, Voxalatamab Biosimilar can inhibit its activity and prevent cancer cells from growing and spreading.

In addition to PSMA, Voxalatamab Biosimilar also targets CD3e, a protein found on the surface of T-cells. By binding to CD3e, Voxalatamab Biosimilar can activate T-cells, which are a crucial part of the immune system. This activation leads to the destruction of cancer cells, making Voxalatamab Biosimilar a potent anti- cancer agent.

Applications of Voxalatamab Biosimilar

Voxalatamab Biosimilar has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer. Its main application is in the treatment of prostate cancer, where it has shown significant efficacy in both pre-clinical and clinical studies.

In addition to prostate

cancer, Voxalatamab Biosimilar is also being investigated for its potential in other types of cancer, such as breast cancer, lung cancer, and ovarian cancer. Its dual targeting of PSMA and CD3e makes it a versatile therapeutic agent that can potentially be used in a wide range of cancers.

Research Grade of Voxalatamab Biosimilar

Voxalatamab Biosimilar is currently in the research grade stage, which means it is still undergoing extensive testing and evaluation. This stage is crucial in determining the safety and efficacy of the antibody before it can be approved for clinical use. The research grade stage also allows for further optimization of the antibody, such as increasing its potency and reducing any potential side effects.

Conclusion

In conclusion, Voxalatamab Biosimilar is a chimeric monoclonal antibody that targets PSMA and CD3e, two proteins involved in cancer cell growth and survival. Its unique structure and dual targeting make it a potent anti- cancer agent with potential applications in various types of cancer. Currently in the research grade stage, Voxalatamab Biosimilar shows promising results and has the potential to become a valuable addition to the arsenal of cancer treatments.

SDS-PAGE for Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade

SDS-PAGE for Voxalatamab Biosimilar - Anti-PSMA &amp, CD3e mAb - Research Grade

Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade

Flow Cytometry results for Voxalatamab Biosimilar - Anti-PSMA &amp, CD3e mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Voxalatamab Biosimilar - Anti-PSMA &, CD3e mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Voxalatamab Biosimilar - Anti-PSMA & CD3e mAb - Research Grade

There are no reviews yet.

Be the first to review “Voxalatamab Biosimilar – Anti-PSMA & CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products