Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD326-EPCAM recombinant protein

  • PX-P6119
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16422
Molecular weight:
30.58 kDa

319.00

100ug + 319 loyalty points
Met1–Lys265 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD326-EPCAM recombinant protein

Product name Human CD326-EPCAM recombinant protein
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Aliases /Synonyms Epithelial glycoprotein 314, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, EPCAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, M4S1, CD326, Ep-CAM, EGP, Epithelial cell adhesion molecule, M1S2, KSA, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18, Drug Target
Reference PX-P6119
Note For research use only.
Molecular Constructor
Met1–Lys265 His

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind to Edrecolomab Biosimilar - Anti-EPCAM mAb (cat. No.PX-TA1081) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade (cat. No.PX-TA1120) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 55.95M.

Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade (cat. No.PX-TA1170) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 242.66M.

Human CD326-EPCAM recombinant protein

There are no reviews yet.

Be the first to review “Human CD326-EPCAM recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products