Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vorsetuzumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Vorsetuzumab ELISA Kit

Vorsetuzumab ELISA Kit

Product name Vorsetuzumab ELISA Kit
Uniprot ID P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX222
Note For research use only.
Sample type Plasma, Serum
Target Vorsetuzumab
Immunogen Vorsetuzumab

Introduction

Vorsetuzumab is a monoclonal antibody that has been developed as a potential therapeutic target for a variety of diseases. It is a humanized antibody that specifically targets a protein known as CD44, which is involved in cellular adhesion and migration. The Vorsetuzumab ELISA Kit is a valuable tool for researchers and clinicians to measure the levels of this antibody in various biological samples. In this article, we will discuss the structure, activity, and applications of the Vorsetuzumab ELISA Kit.

Structure of Vorsetuzumab

Vorsetuzumab is a monoclonal antibody that is derived from a hybridoma cell line. It is a humanized IgG1 antibody, meaning that it contains human constant regions and mouse variable regions. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are linked to each other by disulfide bonds, while the light chains are linked to the heavy chains by both disulfide bonds and non-covalent interactions.

The variable regions of Vorsetuzumab are responsible for its specificity towards CD44. These regions contain the antigen-binding sites, also known as the complementarity-determining regions (CDRs). The CDRs interact with specific amino acid sequences on the surface of CD44, allowing Vorsetuzumab to bind to and inhibit its activity.

Activity of Vorsetuzumab

The primary activity of Vorsetuzumab is to inhibit the function of CD44. CD44 is a transmembrane glycoprotein that is involved in cell adhesion and migration. It is expressed on a variety of cells, including immune cells, stem cells, and cancer cells. CD44 plays a crucial role in various physiological processes, such as wound healing, tissue regeneration, and immune response.

In cancer, CD44 is often overexpressed and has been linked to tumor growth, invasion, and metastasis. Vorsetuzumab binds to CD44 and prevents its interaction with other molecules, such as hyaluronan, which is a key component of the extracellular matrix. By inhibiting CD44, Vorsetuzumab can potentially slow down tumor growth and metastasis.

Application of Vorsetuzumab ELISA Kit

The Vorsetuzumab ELISA Kit is a valuable tool for measuring the levels of Vorsetuzumab in various biological samples. It is a highly sensitive and specific assay that utilizes the principle of enzyme-linked immunosorbent assay (ELISA). The kit contains all the necessary reagents and components for the quantitative detection of Vorsetuzumab in serum, plasma, cell culture supernatant, and other biological fluids.

The Vorsetuzumab ELISA Kit has numerous applications in both research and clinical settings. In research, it can be used to monitor the levels of Vorsetuzumab in preclinical and clinical studies. This information can help researchers understand the pharmacokinetics and pharmacodynamics of Vorsetuzumab and optimize its dosage and treatment regimen.

In clinical settings, the Vorsetuzumab ELISA Kit can be used to monitor the levels of Vorsetuzumab in patients receiving treatment. This can help clinicians determine the effectiveness of the treatment and make any necessary adjustments. Additionally, the kit can also be used for diagnostic purposes, such as detecting the presence of Vorsetuzumab in patients who have received the antibody as part of their treatment.

Conclusion

In summary, the Vorsetuzumab ELISA Kit is a powerful tool for measuring the levels of Vorsetuzumab in biological samples. It is a highly specific and sensitive assay that can be used in both research and clinical settings. Vorsetuzumab, with its unique structure and activity, has the potential to be a valuable therapeutic target for a variety of diseases, and the

Vorsetuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Vorsetuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products