Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2149-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-fused prodomain kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name PX-TA2149-50
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody
Product name Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody
Product name Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody

Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade: A Promising Antibody for Therapeutic Targeting

Introduction

Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade is a monoclonal antibody (mAb) that has shown great potential in the field of immunotherapy. It is a biosimilar version of the anti-CD152 mAb, also known as CTLA-4, which is a key regulatory molecule involved in the immune response. This biosimilar is currently in the research grade stage and has the potential to be a game-changer in the treatment of various diseases.

Structure of Vilastobart Biosimilar

Vilastobart Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is produced using advanced biotechnology techniques. It has a similar structure to the original anti-CD152 mAb, with a molecular weight of approximately 150 kDa. The antibody is composed of two heavy chains and two light chains, with each chain containing variable and constant regions. The variable regions are responsible for binding to the target molecule, while the constant regions determine the antibody’s effector functions.

Activity of Vilastobart Biosimilar

Vilastobart Biosimilar works by targeting and binding to the CD152 molecule, which is expressed on the surface of T cells. CD152 is a negative regulator of T cell activation, and by binding to it, Vilastobart Biosimilar inhibits its function. This leads to an increase in T cell activation and proliferation, which in turn enhances the immune response against cancer cells or other disease-causing agents. Additionally, Vilastobart Biosimilar has been shown to induce cell death in regulatory T cells, further boosting the immune response.

Application of Vilastobart Biosimilar

Vilastobart Biosimilar has shown promising results in preclinical studies for the treatment of various types of cancer, including melanoma, lung cancer, and bladder cancer. It has also been studied for its potential in treating autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. Additionally, Vilastobart Biosimilar has shown potential in combination therapy with other cancer treatments, such as chemotherapy and other immunotherapies.

Moreover, Vilastobart Biosimilar has the potential to be used in the prevention of transplant rejection. By inhibiting the function of CD152, it can prevent the suppression of the immune response against transplanted organs, increasing the success rate of transplants.

Conclusion

Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade is a promising antibody that has the potential to revolutionize the field of immunotherapy. Its structure, activity, and potential applications make it a valuable tool for targeting CD152 and enhancing the immune response against various diseases. As the research on this biosimilar progresses, it has the potential to become a valuable therapeutic option for patients in need.

Research Grade Vilastobart binds to Mouse CD152 recombinant protein in WB Assay

Research Grade Vilastobart binds to Mouse CD152 recombinant protein in WB Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) can bind Research Grade Vilastobart in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Research Grade Vilastobart

SDS-PAGE for Research Grade Vilastobart

Research Grade Vilastobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products