Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade

  • PX-TA1975-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

Product name Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1975-50
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade: A Novel Antibody for Targeting Hybridoma Growth Factor

Introduction

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a novel antibody developed for targeting the hybridoma growth factor (HGF). This biosimilar is a monoclonal antibody (mAb) that specifically binds to HGF and inhibits its activity, making it a promising therapeutic target for various diseases. In this article, we will explore the structure, activity, and potential applications of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb.

Structure of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using recombinant DNA technology and has been modified to resemble a human antibody. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence that determines its binding specificity to HGF.

The antibody also contains a constant region, which is responsible for its effector functions, and a variable region, which is responsible for binding to HGF. The variable region of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb has been engineered to have a high affinity and specificity for HGF, making it an effective inhibitor of HGF activity.

Activity of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb

HGF is a growth factor that plays a crucial role in cell growth, proliferation, and survival. It is overexpressed in various types of cancer, making it a potential therapeutic target for cancer treatment. Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb binds to HGF and prevents it from binding to its receptor, c-Met, thereby inhibiting its downstream signaling pathways.

This inhibition of HGF activity leads to a decrease in cell growth and survival, making Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb a potential anti- cancer agent. Additionally, HGF has been implicated in various other diseases, such as fibrosis and inflammatory disorders, making Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb a promising candidate for the treatment of these conditions as well.

Applications of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb

The potential applications of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb are vast, given its ability to inhibit HGF activity. As mentioned earlier, its anti- cancer properties make it a promising candidate for cancer treatment. It can be used as a monotherapy or in combination with other anti- cancer agents to enhance its efficacy.

Furthermore, HGF has been implicated in the development of fibrosis, a condition characterized by the excessive accumulation of scar tissue in organs. Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb can potentially prevent or reverse fibrosis by inhibiting HGF activity. It can also be used for the treatment of inflammatory disorders, such as rheumatoid arthritis, where HGF plays a role in inflammation and tissue destruction.

Conclusion

In conclusion, Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb is a novel antibody with a high affinity and specificity for HGF. Its ability to inhibit HGF activity makes it a potential therapeutic agent for various diseases, including cancer, fibrosis, and inflammatory disorders. Further research and clinical trials are needed to fully explore the potential of this biosimilar in the treatment of these conditions.

SDS-PAGE for Research Grade Vamikibart

SDS-PAGE for Research Grade Vamikibart

Research Grade Vamikibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Vamikibart in WB Assay

Research Grade Vamikibart in WB Assay

Research Grade Vamikibart can bind to its target in Western Blot Assay as detected on gel analysis.

Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

There are no reviews yet.

Be the first to review “Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products