Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efbalropendekin Alfa Biosimilar – Anti-IL15 fusion protein – Research Grade

Uniprot ID:
P40933 & Q13261

Original price was: €244.00.Current price is: €200.00.

100ug 18% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade

Product name Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.
Product name Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.
Product name PX-TA1987-50
Uniprot ID P40933 & Q13261
Source CAS: 2736449-62-8
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15, IL-15 receptor subunit alpha, sIL-15R-alpha, IL-15RA, CD215, sIL-15 receptor subunit alpha, Interleukin-15 receptor subunit alpha, IL-15R-alpha, sIL-15RA, IL15RA
Reference PX-TA1987
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human interleukin-15/IL-15 fragment variant fused via peptide linker to a human IgG1 C-terminal Fc fragment disulfide bridge with human interleukin-15 receptor subunit alpha fragment fused via a peptide linker to a human immunoglobulin G1 Fc fragment.

Introduction

Efbalropendekin Alfa Biosimilar is a novel fusion protein that has shown promising results in the treatment of various autoimmune and inflammatory diseases. This anti-IL15 fusion protein is a biosimilar of a well-known therapeutic antibody, with the potential to provide an effective and affordable treatment option for patients. In this article, we will discuss the structure, activity, and potential applications of Efbalropendekin Alfa Biosimilar in detail.

Structure of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar is a fusion protein composed of two components – the extracellular domain of the IL-15 receptor alpha chain and the Fc region of human IgG1. The extracellular domain of the IL-15 receptor alpha chain is responsible for binding to IL-15, while the Fc region of human IgG1 provides stability and half-life extension to the fusion protein. The fusion protein has a molecular weight of approximately 85 kDa and is produced through recombinant DNA technology.

Activity of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar acts as a competitive inhibitor of IL-15, a cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases. IL-15 is known to promote the proliferation and survival of immune cells such as T cells, B cells, and natural killer cells, which contribute to the inflammatory response. By binding to IL-15, Efbalropendekin Alfa Biosimilar prevents its interaction with the IL-15 receptor and inhibits its downstream signaling pathways. This leads to a decrease in the production of pro-inflammatory cytokines and the suppression of immune cell activation, ultimately resulting in the attenuation of the inflammatory response.

Therapeutic Target of Efbalropendekin Alfa Biosimilar

The therapeutic target of Efbalropendekin Alfa Biosimilar is IL-15, a cytokine that has been implicated in the pathogenesis of various autoimmune and inflammatory diseases. IL-15 is known to play a crucial role in the development and progression of diseases such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. By targeting IL-15, Efbalropendekin Alfa Biosimilar has the potential to provide a therapeutic benefit for patients suffering from these diseases.

Potential Applications of Efbalropendekin Alfa Biosimilar

Efbalropendekin Alfa Biosimilar has shown promising results in preclinical studies for the treatment of various autoimmune and inflammatory diseases. It has been shown to effectively reduce disease severity and improve clinical symptoms in animal models of rheumatoid arthritis, psoriasis, and inflammatory bowel disease. Additionally, the biosimilar has also demonstrated a good safety profile in these studies.

Furthermore, Efbalropendekin Alfa Biosimilar has the potential to be used in combination therapy with other biologic agents, such as anti-TNF drugs, to enhance its therapeutic efficacy. This could provide an alternative treatment option for patients who do not respond to anti-TNF therapy alone.

Conclusion

In summary, Efbalropendekin Alfa Biosimilar is a novel fusion protein that acts as a competitive inhibitor of IL-15, a cytokine involved in the pathogenesis of various autoimmune and inflammatory diseases. The biosimilar has a unique structure and has shown promising results in preclinical studies for the treatment of diseases such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. With its potential to provide an effective and affordable treatment option, Efbalropendekin Alfa Biosimilar has the potential to make a significant impact in the field of autoimmune and inflammatory disease therapeutics.

Efbalropendekin Alfa Biosimilar - Anti-IL15 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Efbalropendekin Alfa Biosimilar – Anti-IL15 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products