Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nesvacumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Nesvacumab ELISA Kit

Nesvacumab ELISA Kit

Product name Nesvacumab ELISA Kit
Uniprot ID O15123
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX117
Note For research use only.
Sample type Plasma, Serum
Target Nesvacumab
Immunogen Nesvacumab

Introduction to Nesvacumab ELISA Kit

Nesvacumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Nesvacumab in biological samples. This kit utilizes the enzyme-linked immunosorbent assay (ELISA) technique, which is a widely used method in the field of immunology for the detection and measurement of various molecules, including antibodies and antigens.

Structure of Nesvacumab

Nesvacumab is a humanized monoclonal antibody that specifically targets the vascular endothelial growth factor (VEGF). It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL).

The variable domains of Nesvacumab are responsible for its high specificity and binding affinity towards VEGF. This allows the antibody to specifically recognize and bind to VEGF, preventing its interaction with its receptors on the surface of endothelial cells. This ultimately leads to the inhibition of VEGF-mediated angiogenesis, which is the formation of new blood vessels, and tumor growth.

Activity of Nesvacumab

Nesvacumab is a potent inhibitor of VEGF, which plays a critical role in the growth and survival of cancer cells. VEGF promotes the formation of new blood vessels, which supply nutrients and oxygen to tumors, allowing them to grow and spread. By binding to VEGF, Nesvacumab blocks its activity and prevents the formation of new blood vessels, ultimately inhibiting tumor growth.

In addition to its anti-angiogenic activity, Nesvacumab also has immunomodulatory effects. It has been shown to enhance the body’s immune response against cancer cells by stimulating the activity of immune cells such as natural killer cells and T cells. This makes Nesvacumab a promising therapeutic agent for the treatment of various cancers.

Application of Nesvacumab ELISA Kit

Nesvacumab ELISA Kit is a valuable tool for the detection and quantification of Nesvacumab in biological samples. It is commonly used in clinical settings for monitoring the levels of Nesvacumab in patients undergoing treatment with this antibody. This allows for the optimization of dosing and the assessment of treatment response.

In addition, Nesvacumab ELISA Kit is also used in research laboratories for the development and validation of novel therapies targeting VEGF. It is a crucial tool for studying the pharmacokinetics and pharmacodynamics of Nesvacumab and evaluating its efficacy in preclinical and clinical studies.

Furthermore, Nesvacumab ELISA Kit can also be used for the detection of anti-drug antibodies (ADAs) in patients receiving Nesvacumab therapy. ADAs are antibodies produced by the body in response to the administration of a foreign substance, such as a therapeutic antibody. Monitoring ADAs is essential for assessing the potential immunogenicity of Nesvacumab and its impact on treatment efficacy and safety.

Conclusion

Nesvacumab ELISA Kit is a valuable tool for the detection and quantification of Nesvacumab, a humanized monoclonal antibody targeting VEGF. This kit is widely used in clinical and research settings for the monitoring of Nesvacumab levels, the development of novel therapies, and the assessment of immunogenicity. Its high sensitivity and specificity make it an essential tool for the advancement of cancer treatment and research.

Nesvacumab ELISA Kit

There are no reviews yet.

Be the first to review “Nesvacumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products