Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Transcriptional regulator MraZ(mraZ)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
B4TXG9
Molecular weight:
18.64kDa

€210.00

50ug + 210 loyalty points
full length
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Transcriptional regulator MraZ(mraZ)

Product name Transcriptional regulator MraZ(mraZ)
Uniprot ID B4TXG9
Uniprot link http://www.uniprot.org/uniprot/B4TXG9
Expression system Prokaryotic expression
Raw Antigen Sequence MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL
Molecular weight 18.64kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4518
Note For research use only
Molecular Constructor
full length
Product name Transcriptional regulator MraZ(mraZ)
Uniprot ID B4TXG9
Uniprot link http://www.uniprot.org/uniprot/B4TXG9
Expression system Prokaryotic expression
Raw Antigen Sequence MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL
Molecular weight 18.64kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4518
Note For research use only
Molecular Constructor
full length

General Information about Transcriptional regulator MraZ

The proximal end of the division and cell wall (dcw) gene cluster negatively regulates its own expression and subsequent gene expression. Works by directly binding to DNA. It can also regulate the expression of genes outside the dcw cluster

Transcriptional regulator MraZ(mraZ)

There are no reviews yet.

Be the first to review “Transcriptional regulator MraZ(mraZ)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products