Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human RETN Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9HD89
Molecular weight:
10.55 kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Unknown Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human RETN Recombinant Protein

Product name Human RETN Recombinant Protein
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name Human RETN Recombinant Protein
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name Human RETN Recombinant Protein
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name Human RETN Recombinant Protein
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P3048-5-1MG
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P3048-5-50
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P3048-1MG
Uniprot ID Q9HD89
Uniprot link http://www.uniprot.org/uniprot/Q9HD89
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight 10.55 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
NCBI Reference Q9HD89
Aliases /Synonyms ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Reference PX-P3048
Note For research use only
Molecular Constructor
Unknown Yes

Human RETN Recombinant Protein

There are no reviews yet.

Be the first to review “Human RETN Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products