Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human UFD Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q92890
Molecular weight:
30,24 kDa

Original price was: €244.00.Current price is: €210.00.

50ug 14% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human UFD Recombinant Protein

Product name Human UFD Recombinant Protein
Uniprot ID Q92890
Uniprot link http://www.uniprot.org/uniprot/Q92890
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLVADEGICYLPHWMMQNLLLEEDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEEGGLVQVESVNLQ VATYSKFQPQSADFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIHECDMNVDFDAPLGYK EPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLV KKVEEDEAGGRFVAFSGEGQSLRKKGRKP
Molecular weight 30,24 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer 75mM NaH2PO4, NaCl 150mM, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID 7353
Spec:NCBI Gene Aliases UFD1
Spec:SwissProtID Q92890
NCBI Reference AAD08720.1
Aliases /Synonyms UFD∆Nter, ubiquitin fusion-degradation 1 like protein
Reference PX-P1166
Note For research use only
Molecular Constructor
Partial Yes
Product name Human UFD Recombinant Protein
Uniprot ID Q92890
Uniprot link http://www.uniprot.org/uniprot/Q92890
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLVADEGICYLPHWMMQNLLLEEDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEEGGLVQVESVNLQ VATYSKFQPQSADFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIHECDMNVDFDAPLGYK EPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLV KKVEEDEAGGRFVAFSGEGQSLRKKGRKP
Molecular weight 30,24 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer 75mM NaH2PO4, NaCl 150mM, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID 7353
Spec:NCBI Gene Aliases UFD1
Spec:SwissProtID Q92890
NCBI Reference AAD08720.1
Aliases /Synonyms UFD∆Nter, ubiquitin fusion-degradation 1 like protein
Reference PX-P1166
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1166-1MG
Uniprot ID Q92890
Uniprot link http://www.uniprot.org/uniprot/Q92890
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLVADEGICYLPHWMMQNLLLEEDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEEGGLVQVESVNLQ VATYSKFQPQSADFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIHECDMNVDFDAPLGYK EPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLV KKVEEDEAGGRFVAFSGEGQSLRKKGRKP
Molecular weight 30,24 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer 75mM NaH2PO4, NaCl 150mM, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID 7353
Spec:NCBI Gene Aliases UFD1
Spec:SwissProtID Q92890
NCBI Reference AAD08720.1
Aliases /Synonyms UFD∆Nter, ubiquitin fusion-degradation 1 like protein
Reference PX-P1166
Note For research use only
Molecular Constructor
Partial Yes

Human UFD Recombinant Protein

There are no reviews yet.

Be the first to review “Human UFD Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products