Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Marinobacter MARHY0478 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Marinobacter
Uniprot ID:
H8WEC1
Molecular weight:
46,10 kDa

€210.00

+ 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Marinobacter MARHY0478 Recombinant Protein

Marinobacter MARHY0478 Recombinant Protein

Product name Marinobacter MARHY0478 Recombinant Protein
Uniprot ID H8WEC1
Uniprot link http://www.uniprot.org/uniprot/H8WEC1
Origin species Marinobacter
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMGNLGTSYGVMPVDVATAQSLSMFNEQVSATYYNPAALTKDPRGELTAGILHSEQELRSDNPNASGDIV SDSPSQHVLIGMKTNLGSLTRFGHPIYLGFIAGVEKYGKEMLAFSSETSESGQFLQYGKEPLFLNIGGATPIWRGISAGA SVRVTLEATANLDAVSTLGGETSRERLAVNAEPSLKTILGTNIDLGSTFCPESDCFLNGWETALTYRTKSSASTTVDSNI IVTQTIPDPGLSLAVTTIDSFQPETIAIGTQYSGDGWRIGGSIEQQNWSELEDEFSGDSIKDQGSVASGNRIGFDDILIP RLGAEYQLNKNFAVRGGVAYEESPLKTTRNPELNYLDTDKLVVGLGISATYDRTRLLAYPVRLDLGYQYQQLQERDFTVV DYDGDETSVTADGDIHVFSGSITLKF
Molecular weight 46,10 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS pH 7.4 with imidazole 250mM and Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession H8WEC1
Spec:Entrez GeneID 12921111
Spec:SwissProtID H8WEC1
NCBI Reference H8WEC1
Aliases /Synonyms MARHY0478, long-chain fatty acid transporter, Putative hydrophobic compounds transporter
Reference PX-P1123
Note For research use only
Molecular Constructor
Partial Yes
Product name Marinobacter MARHY0478 Recombinant Protein
Uniprot ID H8WEC1
Uniprot link http://www.uniprot.org/uniprot/H8WEC1
Origin species Marinobacter
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMGNLGTSYGVMPVDVATAQSLSMFNEQVSATYYNPAALTKDPRGELTAGILHSEQELRSDNPNASGDIV SDSPSQHVLIGMKTNLGSLTRFGHPIYLGFIAGVEKYGKEMLAFSSETSESGQFLQYGKEPLFLNIGGATPIWRGISAGA SVRVTLEATANLDAVSTLGGETSRERLAVNAEPSLKTILGTNIDLGSTFCPESDCFLNGWETALTYRTKSSASTTVDSNI IVTQTIPDPGLSLAVTTIDSFQPETIAIGTQYSGDGWRIGGSIEQQNWSELEDEFSGDSIKDQGSVASGNRIGFDDILIP RLGAEYQLNKNFAVRGGVAYEESPLKTTRNPELNYLDTDKLVVGLGISATYDRTRLLAYPVRLDLGYQYQQLQERDFTVV DYDGDETSVTADGDIHVFSGSITLKF
Molecular weight 46,10 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS pH 7.4 with imidazole 250mM and Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession H8WEC1
Spec:Entrez GeneID 12921111
Spec:SwissProtID H8WEC1
NCBI Reference H8WEC1
Aliases /Synonyms MARHY0478, long-chain fatty acid transporter, Putative hydrophobic compounds transporter
Reference PX-P1123
Note For research use only
Molecular Constructor
Partial Yes

General information on Marinobacter MARHY0478 Recombinant Protein:

Immunodominant protein p72 from Mycoplasma mycoides subsp. mycoides SC is a member of the mycoplasma p72 lipoprotein family. It has been shown to be a surface-exposed lipoprotein of Mycoplasma mycoides subsp. mycoides SC. The protein may play an essential role in virulence.

  • Grimaud R, Ghiglione JF, Cagnon C, Lauga B, Vaysse PJ, Rodriguez-Blanco A, Mangenot S, Cruveiller S, Barbe V, Duran R, Wu LF, Talla E, Bonin P, Michotey V. Genome sequence of the marine bacterium Marinobacter hydrocarbonoclasticus SP17, which forms biofilms on hydrophobic organic compounds. J Bacteriol. 2012 Jul;194(13):3539-40. doi: 10.1128/JB.00500-12. PubMed PMID: 22689231; PubMed Central PMCID: PMC3434751.

There are no reviews yet.

Be the first to review “Marinobacter MARHY0478 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products