Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse PD-1 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q02242
Molecular weight:
15.73 kDa

299.00

100ug + 299 loyalty points
Leu25–Gln167 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse PD-1 recombinant protein

Product name Mouse PD-1 recombinant protein
Uniprot ID Q02242
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPE
Molecular weight 15.73 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu25-Gln167
Aliases /Synonyms Pd1, CD279
Reference PX-P6064
Note For research use only
Molecular Constructor
Leu25–Gln167 His

General information on Mouse PD-1 recombinant protein

Structure of Mouse PD-1 Recombinant Protein

Mouse PD-1 is a type I transmembrane glycoprotein and a member of the CD protein family. It is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic domain. The extracellular domain is composed of two Ig-like domains and a short stalk region.

Activity of Mouse PD-1 Recombinant Protein

Mouse PD-1 is an immune checkpoint protein that plays an important role in regulating the immune system. It binds to its ligands, PD-L1 and PD-L2, to inhibit T-cell activation and suppress the immune response.

Application of Mouse PD-1 Recombinant Protein

Mouse PD-1 recombinant protein is used in research to study the role of PD-1 in immune regulation and the development of novel therapeutics for autoimmune and cancer diseases. It is also used in the development of diagnostic tests to detect the expression of PD-1 in cells.

Mouse PD-1 recombinant protein

There are no reviews yet.

Be the first to review “Mouse PD-1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products