Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

TNFSF15/TL1A Monoclonal Antibody

  • PTX20632-50
  • Validated ELISA

Original price was: €289.00.Current price is: €239.00.

50ug 17% OFF + 239 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

TNFSF15/TL1A Monoclonal Antibody

Product name PTX20632-100
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A
Product name PTX20632-1MG
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A
Product name PTX20632-50
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A

TNFSF15/TL1A Monoclonal Antibody binds to Human TNFSF15/TL1A recombinant protein in ELISA Assay

TNFSF15/TL1A Monoclonal Antibody binds to Human TNFSF15/TL1A recombinant protein in ELISA Assay

Human TNFSF15/TL1A recombinant protein(cat. No.PX-P6413) at 0.5µg/mL (100µL/well) can bind TNFSF15/TL1A Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for TNFSF15/TL1A Monoclonal Antibody

SDS-PAGE for TNFSF15/TL1A Monoclonal Antibody

TNFSF15/TL1A Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

TNFSF15/TL1A Monoclonal Antibody

There are no reviews yet.

Be the first to review “TNFSF15/TL1A Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products