Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enokizumab Biosimilar – Anti-IL9 mAb – Research Grade

  • PX-TA1254-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Product name Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1254-50
Uniprot ID P15248
Source CAS 909875-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Enokizumab,7F3com-2H2,MEDI-528,IL9,anti-IL9
Reference PX-TA1254
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL9[Homo sapiens] (Enokizumab) Monoclonal Antibody

Enokizumab has been investigated for the treatment of asthma.

SDS-PAGE for Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

SDS-PAGE for Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

SEC-HPLC of Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

Enokizumab Biosimilar - Anti-IL9 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Enokizumab Biosimilar - Anti-IL9 mAb - Research Grade

There are no reviews yet.

Be the first to review “Enokizumab Biosimilar – Anti-IL9 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products