Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suvemcitug Biosimilar – Anti-Vascular endothelial growth factor A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade

Product name Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1939-50
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: Suvemcitug Biosimilar: A Promising Anti-VEGF Therapy for Various Diseases Introduction

Suvemcitug Biosimilar is a research grade monoclonal antibody (mAb) that targets the vascular endothelial growth factor A (VEGF-A) protein. It is a biosimilar version of the well-known anti-VEGF therapy, Bevacizumab, and has shown promising results in preclinical studies. In this article, we will explore the structure, activity, and potential applications of Suvemcitug Biosimilar.

Structure of Suvemcitug Biosimilar

Suvemcitug Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 149 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1-CH3) and a variable domain (VH), while the light chains consist of two constant domains (CL) and a variable domain (VL). The variable domains are responsible for binding to the VEGF-A protein.

Activity of Suvemcitug Biosimilar

Suvemcitug Biosimilar binds specifically to the VEGF-A protein, which is a key regulator of angiogenesis (formation of new blood vessels). VEGF-A is overexpressed in various diseases, including cancer, age-related macular degeneration, and diabetic retinopathy. By binding to VEGF-A, Suvemcitug Biosimilar inhibits its activity and prevents the formation of new blood vessels, thereby reducing the blood supply to the diseased tissues.

Application of Suvemcitug Biosimilar

1.

Cancer Treatment

One of the major applications of Suvemcitug Biosimilar is in the treatment of cancer. VEGF-A is known to promote tumor growth and metastasis by stimulating the formation of new blood vessels. By blocking the activity of VEGF-A, Suvemcitug Biosimilar can inhibit tumor growth and spread, making it a potential therapeutic option for various types of cancer.

2. Ophthalmic Diseases Suvemcitug Biosimilar has also shown potential in the treatment of ophthalmic diseases, such as age-related macular degeneration and diabetic retinopathy. In these diseases, VEGF-A plays a critical role in the development of abnormal blood vessels in the retina, leading to vision loss. By targeting VEGF-A, Suvemcitug Biosimilar can prevent the formation of these abnormal blood vessels and preserve vision.

3. Inflammatory Diseases VEGF-A is also involved in the pathogenesis of various inflammatory diseases, such as rheumatoid arthritis and psoriasis. By blocking the activity of VEGF-A, Suvemcitug Biosimilar can reduce inflammation and provide relief to patients suffering from these conditions.

4. Cardiovascular Diseases Recent studies have shown that VEGF-A also plays a role in the development of cardiovascular diseases, such as atherosclerosis and hypertension. Suvemcitug Biosimilar has the potential to inhibit the formation of new blood vessels in the diseased tissues and improve the overall cardiovascular health of patients.

Conclusion

Suvemcitug Biosimilar is a promising anti-VEGF therapy that has the potential to treat a wide range of diseases. Its specific binding to VEGF-A makes it a highly targeted and effective treatment option. With ongoing clinical trials, Suvemcitug Biosimilar has the potential to become a valuable addition to the current treatment options for various diseases.

SDS-PAGE for Research Grade Suvemcitug

SDS-PAGE for Research Grade Suvemcitug

Research Grade Suvemcitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade

There are no reviews yet.

Be the first to review “Suvemcitug Biosimilar – Anti-Vascular endothelial growth factor A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products