Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suptavumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Suptavumab ELISA Kit

Suptavumab ELISA Kit

Product name Suptavumab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX285
Note For research use only.
Sample type Plasma, Serum
Target Suptavumab
Immunogen Suptavumab

Suptavumab ELISA Kit: A Powerful Tool for Antibody Detection and Therapeutic Targeting The Suptavumab ELISA Kit is a cutting-edge laboratory tool that has revolutionized the field of antibody detection and therapeutic targeting. This kit utilizes the enzyme-linked immunosorbent assay (ELISA) technique to accurately and efficiently measure the levels of supatavumab, a monoclonal antibody, in various biological samples. In this article, we will explore the structure, activity, and applications of the Suptavumab ELISA Kit in detail.

Structure of Suptavumab ELISA Kit

The Suptavumab ELISA Kit is composed of several components, including a 96-well microplate, a set of standards, controls, and reagents. The microplate is coated with a specific antigen that binds to supatavumab, allowing for the capture of the antibody from the sample. The standards and controls are used to establish a standard curve and validate the accuracy and precision of the assay. The reagents include a detection antibody, enzyme conjugate, and substrate, which work together to produce a measurable signal that is directly proportional to the amount of supatavumab present in the sample.

Activity of Suptavumab ELISA Kit

The activity of the Suptavumab ELISA Kit is based on the principles of ELISA, which is a highly sensitive and specific technique for the detection and quantification of various molecules, including antibodies. The assay involves several steps, including sample preparation, incubation, washing, and detection. The sample is first added to the microplate and allowed to incubate, allowing for the capture of supatavumab by the antigen-coated wells. After washing to remove any unbound components, the detection antibody is added, which binds to the captured supatavumab. This is followed by the addition of the enzyme conjugate, which produces a color change upon interaction with the substrate. The intensity of the color is directly proportional to the amount of supatavumab present in the sample, which can be measured using a spectrophotometer.

Applications of Suptavumab ELISA Kit

The Suptavumab ELISA Kit has a wide range of applications in both research and clinical settings. One of its primary uses is in the detection and quantification of supatavumab in biological samples, such as serum, plasma, and cell culture supernatants. This allows for the monitoring of supatavumab levels in patients receiving treatment with this antibody, providing valuable insights into its efficacy and pharmacokinetics. Additionally, the Suptavumab ELISA Kit can also be used to screen for the presence of supatavumab in potential therapeutic candidates, allowing for the selection of the most effective and specific antibodies for further development.

Moreover, the Suptavumab ELISA Kit can also be used in the development of new therapies targeting supatavumab. By accurately measuring the levels of this antibody in different biological samples, researchers can gain a better understanding of its role in various diseases and design targeted therapies to modulate its activity. This makes the Suptavumab ELISA Kit an invaluable tool in the development of novel treatments for a wide range of conditions, including cancer, autoimmune disorders, and infectious diseases.

Conclusion

The Suptavumab ELISA Kit is a powerful and versatile laboratory tool that has greatly advanced the field of antibody detection and therapeutic targeting. Its accurate and sensitive measurement of supatavumab levels in various biological samples makes it an essential tool for researchers and clinicians alike. With its wide range of applications and potential for the development of new therapies, the Suptavumab ELISA Kit is a must-have for any laboratory working with antibodies and their therapeutic targets.

Suptavumab ELISA Kit

There are no reviews yet.

Be the first to review “Suptavumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products