Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suptavumab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

  • PX-TA1429-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

Product name Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Source CAS 1629615-23-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Suptavumab,H1H3592P3,REGN 2222,SAR-438584,SAR438584,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1429
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Source CAS 1629615-23-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Suptavumab,H1H3592P3,REGN 2222,SAR-438584,SAR438584,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1429
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1429-50
Uniprot ID P03420
Source CAS 1629615-23-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Suptavumab,H1H3592P3,REGN 2222,SAR-438584,SAR438584,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1429
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-RSV glycoprotein F[Respiratory syncytial virus] (Suptavumab) Monoclonal Antibody

Suptavumab has been investigated for the treatment and basic science of Respiratory Syncytial Virus Infections.

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind to Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb (cat. No.PX-TA1429) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Suptavumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SDS-PAGE for Suptavumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Suptavumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

There are no reviews yet.

Be the first to review “Suptavumab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products