Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade

Isotype:
IgG1-nd

Original price was: €250.00.Current price is: €200.00.

100ug 20% OFF + 200 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb
Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay
Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1144-50
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for human use.
Isotype IgG1-nd

General information on Anti-MSTN/GDF-8(Homo sapiens) (Stamulumab) Monoclonal Antibody

Stamulumab is an experimental drug that inhibits myostatin and can be used to treat muscular dystrophy (MD). Myostatin is a protein that inhibits the growth of muscle tissue. Stamulumab is a recombinant human antibody targetting and inhibiting the activity of myostatin. It is a G1 immunoglobulin antibody that can bind to myostatin and prevent it from binding to its target site, thereby inhibiting the growth-limiting effect of myostatin on muscle tissue.

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay

Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay

Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

  • Francesca Torrini, Federica Battaglia, Davide Sestaioni, Pasquale Palladino, Simona Scarano, Maria Minunni, Monoclonal antibodies (mAbs) optical detection by coupling innovative imprinted biopolymers and magnetic beads: The case of therapeutic mAb anti-myostatin detection, Sensors and Actuators B: Chemical, Volume 383, 2023, 133586, ISSN 0925-4005, https://doi.org/10.1016/j.snb.2023.133586.

There are no reviews yet.

Be the first to review “Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products