Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade

Isotype:
IgG1-nd

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1144-50
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for human use.
Isotype IgG1-nd

General information on Anti-MSTN/GDF-8(Homo sapiens) (Stamulumab) Monoclonal Antibody

Stamulumab is an experimental drug that inhibits myostatin and can be used to treat muscular dystrophy (MD). Myostatin is a protein that inhibits the growth of muscle tissue. Stamulumab is a recombinant human antibody targetting and inhibiting the activity of myostatin. It is a G1 immunoglobulin antibody that can bind to myostatin and prevent it from binding to its target site, thereby inhibiting the growth-limiting effect of myostatin on muscle tissue.

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

SEC-HPLC of Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

  • Francesca Torrini, Federica Battaglia, Davide Sestaioni, Pasquale Palladino, Simona Scarano, Maria Minunni, Monoclonal antibodies (mAbs) optical detection by coupling innovative imprinted biopolymers and magnetic beads: The case of therapeutic mAb anti-myostatin detection, Sensors and Actuators B: Chemical, Volume 383, 2023, 133586, ISSN 0925-4005, https://doi.org/10.1016/j.snb.2023.133586.

There are no reviews yet.

Be the first to review “Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products