Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Adecatumumab Biosimilar – Anti-EPCAM mAb – Research Grade

  • PX-TA1120-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade

Product name Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 503605-66-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Adecatumumab,MT201,EPCAM,anti-EPCAM
Reference PX-TA1120
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 503605-66-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Adecatumumab,MT201,EPCAM,anti-EPCAM
Reference PX-TA1120
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1120-50
Uniprot ID P16422
Source CAS 503605-66-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Adecatumumab,MT201,EPCAM,anti-EPCAM
Reference PX-TA1120
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

The Structure of Adecatumumab Biosimilar

Adecatumumab Biosimilar, also known as Anti-EPCAM mAb, is a monoclonal antibody that specifically targets the epithelial cell adhesion molecule (EPCAM). This antibody is a biosimilar version of the original Adecatumumab, which was developed by Merck Serono for the treatment of various types of cancer.

The structure of Adecatumumab Biosimilar is similar to that of the original Adecatumumab, with a few minor differences. It is a fully human IgG1 monoclonal antibody, meaning that it is composed of four protein chains – two heavy chains and two light chains – that are connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa.

The heavy chains of Adecatumumab Biosimilar contain constant regions (Fc regions) and variable regions (Fab regions). The Fc regions are responsible for the effector functions of the antibody, while the Fab regions are responsible for binding to the target antigen, EPCAM. The light chains also contain constant and variable regions, with the variable regions being responsible for antigen binding.

The Activity of Adecatumumab Biosimilar

Adecatumumab Biosimilar is a highly specific and potent antibody that targets EPCAM, a glycoprotein that is overexpressed in many types of cancer. EPCAM plays a crucial role in cell adhesion and signaling, and its overexpression has been linked to tumor growth, invasion, and metastasis.

Adecatumumab Biosimilar binds to EPCAM with high affinity and specificity, resulting in the formation of an antigen-antibody complex. This complex triggers a series of events that ultimately lead to the destruction of cancer cells. The effector functions of the antibody, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), play a crucial role in this process.

ADCC involves the activation of immune cells, such as natural killer cells and macrophages, which recognize and destroy the EPCAM-expressing cancer cells. CDC, on the other hand, involves the activation of the complement system, a group of proteins that work together to destroy the antibody-bound cancer cells.

The Application of Adecatumumab Biosimilar

Adecatumumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various types of cancer, including colorectal, pancreatic, and breast cancer. In preclinical studies, the antibody has demonstrated potent antitumor activity, inhibiting tumor growth and metastasis in animal models.

In clinical trials, Adecatumumab Biosimilar has been evaluated as a single agent and in combination with other cancer treatments. The results have shown that the antibody is well-tolerated and has a favorable safety profile. It has also shown promising efficacy, with some patients experiencing tumor shrinkage and prolonged survival.

Currently, Adecatumumab Biosimilar is in the research grade stage, meaning that it is not yet approved for clinical use. However, it is being further evaluated in clinical trials to determine its potential as a therapeutic option for cancer patients.

Conclusion

In summary, Adecatumumab Biosimilar is a potent and specific monoclonal antibody that targets EPCAM, a glycoprotein that is overexpressed in many types of cancer. Its structure is similar to the original Adecatumumab, with a fully human IgG1 backbone. The antibody has shown promising results in preclinical and clinical studies, and is currently being evaluated as a potential therapeutic option for cancer patients.

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade (cat. No.PX-TA1120) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 55.95M.

SDS-PAGE for Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade

SDS-PAGE for Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade

There are no reviews yet.

Be the first to review “Adecatumumab Biosimilar – Anti-EPCAM mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products