Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HuCC49 Biosimilar – Anti-FCGR1, ITGB2, TAG-72 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €352.00.Current price is: €259.00.

50ug 26% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade

Product name HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1137-50
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to HuCC49 Biosimilar – Anti-FCGR1, ITGB2, TAG-72 mAb – Research Grade HuCC49 Biosimilar is a monoclonal antibody (mAb) that specifically targets three different proteins: FCGR1, ITGB2, and TAG-72. This biosimilar is a research grade version of the original HuCC49 mAb, which has been extensively studied and used in clinical trials for its potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of HuCC49 Biosimilar in scientific terms.

Structure of HuCC49 Biosimilar

HuCC49 Biosimilar is a recombinant humanized mAb, meaning it is derived from both human and mouse sources. Its structure is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of constant and variable regions, while the light chains only have variable regions. The variable regions are responsible for binding to the specific targets of the mAb.

Activity of HuCC49 Biosimilar

HuCC49 Biosimilar has a high affinity for its three targets: FCGR1, ITGB2, and TAG-72. FCGR1, also known as Fc gamma receptor I, is a protein found on the surface of immune cells. It plays a crucial role in the immune response by binding to the Fc portion of antibodies and triggering various immune functions. HuCC49 Biosimilar binds to FCGR1 with high specificity, which can enhance the immune response against certain diseases.

ITGB2, also known as integrin beta-2, is a protein found on the surface of white blood cells. It is involved in cell adhesion and migration, as well as immune cell activation. HuCC49 Biosimilar binds to ITGB2 and can block its activity, which may have therapeutic benefits in diseases where ITGB2 is overactive, such as inflammatory disorders.

TAG-72 is a tumor-associated antigen found on the surface of many types of cancer cells. HuCC49 Biosimilar has been shown to bind to TAG-72 with high specificity, making it a potential tool for targeted cancer therapy. By binding to TAG-72, HuCC49 Biosimilar can deliver drugs or other therapeutic agents directly to cancer cells, minimizing side effects on healthy cells.

Applications of HuCC49 Biosimilar

The unique targeting ability of HuCC49 Biosimilar makes it a promising candidate for various therapeutic applications. Its potential uses include:

1.

Cancer therapy: As mentioned, HuCC49 Biosimilar has been shown to bind to TAG-72, a tumor-associated antigen. This makes it a potential tool for targeted cancer therapy, where it can deliver drugs or other therapeutic agents directly to cancer cells.

2.

Autoimmune disorders: By binding to ITGB2, HuCC49 Biosimilar can block its activity and potentially alleviate symptoms of autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis.

3.

Infectious diseases: FCGR1 is involved in the immune response against infectious agents. By binding to FCGR1, HuCC49 Biosimilar can enhance the immune response and potentially aid in the treatment of infectious diseases.

Conclusion

In summary, HuCC49 Biosimilar is a research grade version of the original HuCC49 mAb with high specificity for three different targets: FCGR1, ITGB2, and TAG-72. Its unique structure and activity make it a promising candidate for various therapeutic applications, including cancer therapy, autoimmune disorders, and infectious diseases. Further research and clinical trials are needed to fully explore the potential of this biosimilar in the field of medicine.

SDS-PAGE for HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade

SDS-PAGE for HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade

HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade

There are no reviews yet.

Be the first to review “HuCC49 Biosimilar – Anti-FCGR1, ITGB2, TAG-72 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products