Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sovipostobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1951-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1951-50
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Sovipostobart Biosimilar – Anti-CD152 mAb

Sovipostobart Biosimilar – Anti-CD152 mAb is a research grade monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody Ipilimumab. It specifically targets the protein CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), which is a key regulator of T-cell activity. Sovipostobart Biosimilar – Anti-CD152 mAb has been extensively studied and has shown promising results in preclinical and clinical trials as a potential treatment for various types of cancer.

Structure of Sovipostobart Biosimilar – Anti-CD152 mAb

Sovipostobart Biosimilar – Anti-CD152 mAb is a humanized IgG1 monoclonal antibody, meaning it is made up of human and mouse components. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant domains (CH1-CH4) and one variable domain (VH), while the light chains have two constant domains (CL) and one variable domain (VL). The variable domains are responsible for binding to the target protein, CD152, while the constant domains play a role in effector functions such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

Activity of Sovipostobart Biosimilar – Anti-CD152 mAb

The activity of Sovipostobart Biosimilar – Anti-CD152 mAb is primarily mediated by its binding to CD152 on the surface of T-cells. CD152 is a negative regulator of T-cell activation and plays a crucial role in maintaining immune homeostasis. By binding to CD152, Sovipostobart Biosimilar – Anti-CD152 mAb blocks its inhibitory function, leading to increased T-cell activity and enhanced anti-tumor immune response. This mechanism of action is similar to that of the therapeutic antibody Ipilimumab, making Sovipostobart Biosimilar – Anti-CD152 mAb a potential alternative for cancer treatment.

In addition to its direct effect on T-cells, Sovipostobart Biosimilar – Anti-CD152 mAb also has the potential to induce an immune response against tumor cells through its effector functions. The binding of the antibody to CD152 can trigger complement activation and ADCC, resulting in the destruction of cancer cells.

Application of Sovipostobart Biosimilar – Anti-CD152 mAb

Sovipostobart Biosimilar – Anti-CD152 mAb is currently being investigated as a potential treatment for various types of cancer, including melanoma, prostate cancer, and lung cancer. It has shown promising results in preclinical studies, with a significant reduction in tumor growth and improved survival rates in animal models. Clinical trials are also underway to evaluate the safety and efficacy of Sovipostobart Biosimilar – Anti-CD152 mAb in cancer patients.

In addition to its potential as a standalone therapy, Sovipostobart Biosimilar – Anti-CD152 mAb may also have the potential to be used in combination with other cancer treatments, such as chemotherapy and other immunotherapies. This is because it targets a different pathway in the immune system compared to other therapies, allowing for a synergistic effect and potentially improving overall treatment outcomes.

Conclusion

Sovipostobart Biosimilar – Anti-CD152 mAb is a research grade monoclonal antibody that specifically targets the protein CD152 and has shown promising results in preclinical and clinical trials as a potential treatment for various types of cancer. Its unique mechanism of action and potential for combination therapy make it a promising candidate for the future of cancer treatment. Further research and clinical trials are needed to fully evaluate the efficacy and safety of Sovip

Research Grade Sovipostobart binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Sovipostobart binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Sovipostobart in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Sovipostobart

SDS-PAGE for Research Grade Sovipostobart

Research Grade Sovipostobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sovipostobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products