Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

S100A6, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P06703
Molecular weight:
12.49 kDa

€319.00

100ug + 319 loyalty points
His Met1–Gly90
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

S100A6, N-His, recombinant protein

Product name S100A6, N-His, recombinant protein
Uniprot ID P06703
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Molecular weight 12.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly90
Protein Accession P06703
Reference PX-P5909
Note For research use only
Molecular Constructor
His Met1–Gly90

S100A6, N-His, recombinant protein

There are no reviews yet.

Be the first to review “S100A6, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products