Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Stanniocalcin 1

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P52823
Molecular weight:
49.49 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Ser28–Ala247 GST
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Stanniocalcin 1

Product name PX-P4987-100
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST
Product name PX-P4987-1MG
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST
Product name PX-P4987-50
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST

Stanniocalcin 1

There are no reviews yet.

Be the first to review “Stanniocalcin 1”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products