Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ITGAL recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P20701
Molecular weight:
31.16 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
His Asn809–His1066
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

ITGAL recombinant protein

Product name PX-P5176-100
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066
Product name PX-P5176-1MG
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066
Product name PX-P5176-50
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066

SDS-PAGE for ITGAL recombinant protein

SDS-PAGE for ITGAL recombinant protein

ITGAL recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

ITGAL recombinant protein

There are no reviews yet.

Be the first to review “ITGAL recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products