Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse SAA1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P05366
Molecular weight:
24.10 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Gly20–Tyr122
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse SAA1 Protein, N-His-SUMO

Product name ARO-P10611-100
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122
Product name ARO-P10611-1MG
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122
Product name ARO-P10611-50
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122

Introduction to Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein, also known as Serum Amyloid A1 protein, is a highly conserved acute-phase protein that is produced in response to inflammation and tissue damage. It is a member of the Serum Amyloid A (SAA) family, which includes four isoforms (SAA1, SAA2, SAA3, and SAA4) in humans and three isoforms (SAA1, SAA2, and SAA3) in mice. SAA1 is the most abundant isoform in mice and is primarily expressed in the liver, but can also be found in other tissues such as adipose tissue, macrophages, and endothelial cells.

Structure of Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein is a 104 amino acid protein with a molecular weight of approximately 11.6 kDa. It is composed of four alpha-helices and a beta-sheet, which form a compact tertiary structure. SAA1 also contains a highly conserved cysteine residue at position 71, which is essential for the formation of disulfide bonds that stabilize the protein. Recombinant Mouse SAA1 Protein is highly homologous to human SAA1, with a sequence identity of 87%. This high degree of sequence conservation suggests that the function of SAA1 is conserved between species.

Activity of Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein is a multifunctional protein that plays a crucial role in the acute-phase response. It is primarily produced by hepatocytes in response to pro-inflammatory cytokines such as interleukin-1 (IL-1), interleukin-6 (IL-6), and tumor necrosis factor-alpha (TNF-α). SAA1 is released into the circulation where it binds to high-density lipoprotein (HDL) and is transported to sites of inflammation. At these sites, SAA1 can act as an opsonin, promoting the recruitment of immune cells to the site of injury or infection. Additionally, SAA1 can also act as a chemoattractant, stimulating the migration of monocytes, neutrophils, and T cells to the site of inflammation. SAA1 also has antimicrobial properties, as it can directly kill bacteria and inhibit their growth.

In addition to its role in the acute-phase response, SAA1 has been implicated in other biological processes. It has been shown to promote angiogenesis, the formation of new blood vessels, which is important for tissue repair and wound healing. SAA1 also has a role in lipid metabolism, as it can bind to HDL and modulate its function. This may be important in the development of atherosclerosis, as SAA1 has been shown to accumulate in atherosclerotic lesions and promote the formation of foam cells, which are a hallmark of this disease.

Application of Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein has a wide range of applications in both research and clinical settings. In research, it is commonly used as a biomarker for inflammation, as its levels increase rapidly in response to inflammation and tissue damage. It can also be used as a tool to study the role of SAA1 in various biological processes, such as angiogenesis and lipid metabolism. Recombinant Mouse SAA1 Protein is also used in in vitro studies to investigate its antimicrobial properties and its ability to recruit immune cells to sites of inflammation.

In the clinic, SAA1 is used as a diagnostic marker for various inflammatory diseases, such as rheumatoid arthritis, inflammatory bowel disease, and sepsis. Elevated levels of SAA1 in the blood can indicate the presence of inflammation and can be used to monitor the progression of these diseases. SAA1 is also being investigated as a potential therapeutic

Recombinant Mouse SAA1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse SAA1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products