Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD68 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P31996
Molecular weight:
20.57 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gly125–Ser291
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD68 Protein, N-His

Product name ARO-P10588-100
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291
Product name ARO-P10588-1MG
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291
Product name ARO-P10588-50
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291

Introduction

Recombinant Mouse CD68 Protein, also known as Cluster of Differentiation 68, is a glycoprotein that is encoded by the CD68 gene in mice. It is a member of the lysosomal-associated membrane protein (LAMP) family and is primarily expressed in macrophages, monocytes, and dendritic cells. This protein plays a crucial role in various cellular processes such as endocytosis, phagocytosis, and antigen presentation. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD68 Protein.

Structure of Recombinant Mouse CD68 Protein

Recombinant Mouse CD68 Protein is a transmembrane glycoprotein with a molecular weight of approximately 110 kDa. It consists of 354 amino acids and has a single transmembrane domain. The extracellular region of this protein contains a heavily glycosylated N-terminal domain and a C-terminal domain. The cytoplasmic region of CD68 contains a conserved lysosomal-targeting signal, which is responsible for its localization to lysosomes.

Activity of Recombinant Mouse CD68 Protein

Recombinant Mouse CD68 Protein is primarily involved in the process of endocytosis and phagocytosis. It acts as a scavenger receptor and binds to various ligands, including modified low-density lipoproteins, lipopolysaccharides, and apoptotic cells. This binding triggers the internalization of these ligands into the cell, where they are degraded by lysosomal enzymes.

Apart from its role in endocytosis and phagocytosis, Recombinant Mouse CD68 Protein also plays a crucial role in antigen presentation. It is expressed on the surface of antigen-presenting cells, such as macrophages and dendritic cells, and is involved in the processing and presentation of antigens to T cells. This process is essential for the activation of the immune response against foreign pathogens.

Applications of Recombinant Mouse CD68 Protein

Recombinant Mouse CD68 Protein has various applications in the field of research and biotechnology. One of the most significant applications of this protein is in the study of macrophage biology. As CD68 is primarily expressed in macrophages, its recombinant form can be used as a marker to identify and isolate these cells from other cell types. This is particularly useful in studying the role of macrophages in various diseases and conditions.

Another important application of Recombinant Mouse CD68 Protein is in cancer research. CD68 is known to be overexpressed in various cancer types, including breast cancer, ovarian cancer, and prostate cancer. The recombinant form of this protein can be used to develop diagnostic tools for these cancers, as well as potential therapeutic targets.

Furthermore, Recombinant Mouse CD68 Protein is also used in the development of vaccines and immunotherapies. As this protein is involved in antigen presentation, it can be used to enhance the immune response against specific antigens. This has significant implications in the treatment of infectious diseases and cancer.

Conclusion

In conclusion, Recombinant Mouse CD68 Protein is a vital protein that plays a crucial role in various cellular processes, including endocytosis, phagocytosis, and antigen presentation. Its structure, activity, and applications make it a valuable tool in the field of research and biotechnology. With further research and development, this protein has the potential to contribute to the development of new treatments for various diseases and conditions.

Recombinant Mouse CD68 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD68 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products