Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9D8T2
Molecular weight:
42.87 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Met1–Asp276
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Product name ARO-P10935-100
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276
Product name ARO-P10935-1MG
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276
Product name ARO-P10935-50
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276

Introduction to Recombinant Mouse GSDMD/Gasdermin-D Protein

Recombinant Mouse GSDMD/Gasdermin-D Protein is a protein that has been genetically engineered to be produced in large quantities for research and therapeutic purposes. It belongs to the gasdermin family of proteins and is involved in a process known as pyroptosis, which is a form of programmed cell death. This protein has gained significant interest in the scientific community due to its potential role in various diseases and its potential as a therapeutic target.

Structure of Recombinant Mouse GSDMD/Gasdermin-D Protein

The recombinant mouse GSDMD/Gasdermin-D protein is composed of 486 amino acids and has a molecular weight of approximately 54 kDa. It is a member of the gasdermin family of proteins, which are characterized by a conserved gasdermin domain (GSDMD) at the C-terminus. This domain contains a pore-forming region that is essential for its function in pyroptosis.

The protein also has an N-terminal domain, which is responsible for its interaction with other proteins and its localization within the cell. This domain is highly conserved among gasdermin family members and is essential for the regulation of pyroptosis.

Activity of Recombinant Mouse GSDMD/Gasdermin-D Protein

Recombinant Mouse GSDMD/Gasdermin-D Protein is primarily known for its role in pyroptosis, which is a form of programmed cell death that is triggered by infection or cellular stress. In this process, the protein is activated by proteolytic cleavage, leading to the formation of a pore in the cell membrane. This pore allows for the release of pro-inflammatory cytokines and danger signals, ultimately leading to cell death.

In addition to its role in pyroptosis, GSDMD has also been implicated in other cellular processes, such as cell migration and wound healing. It has been shown to interact with other proteins involved in these processes, suggesting a potential role in tissue repair and regeneration.

Application of Recombinant Mouse GSDMD/Gasdermin-D Protein

The recombinant mouse GSDMD/Gasdermin-D protein has a wide range of applications in both research and therapeutic settings. Its role in pyroptosis makes it a valuable tool for studying the mechanisms of cell death and inflammation in various diseases. It has been linked to several inflammatory disorders, such as sepsis, inflammatory bowel disease, and cancer, making it a potential target for drug development.

Furthermore, recombinant GSDMD protein has been used in various in vitro and in vivo studies to investigate its function and potential therapeutic applications. For example, it has been used to study the role of pyroptosis in cancer cell death and to develop novel treatments for inflammatory diseases.

Additionally, recombinant GSDMD protein has also been used in diagnostic assays to detect its expression levels in various diseases. Its overexpression has been linked to various cancers, making it a potential biomarker for cancer diagnosis and prognosis.

Conclusion

In summary, Recombinant Mouse GSDMD/Gasdermin-D Protein is a valuable tool for studying the mechanisms of pyroptosis and its potential role in various diseases. Its structure, activity, and potential applications make it a promising candidate for further research and therapeutic development. With its potential to shed light on the complex processes of cell death and inflammation, this protein holds great promise for the future of biomedical research and medicine.

SDS-PAGE for Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

SDS-PAGE for Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products