Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CLEC11A Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O88200
Molecular weight:
44.41 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gly185–Phe328
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CLEC11A Protein, N-GST & C-His

Product name ARO-P10621-100
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328
Product name ARO-P10621-1MG
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328
Product name ARO-P10621-50
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328

Introduction

Recombinant Mouse CLEC11A Protein, also known as C-type lectin domain family 11 member A, is a protein that is commonly used in scientific research and biotechnology applications. This protein is a member of the C-type lectin domain family, which are a group of proteins that contain a carbohydrate-binding domain known as the C-type lectin domain.

Structure of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein is a glycoprotein that is composed of 175 amino acids. It has a molecular weight of approximately 19.5 kDa and contains a single C-type lectin domain. This protein also contains a signal peptide, a propeptide, and a transmembrane region. The C-type lectin domain is responsible for the binding of carbohydrates, and it is highly conserved among members of the C-type lectin family.

Activity of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein is known to play a role in the regulation of immune responses. It is primarily expressed in immune cells such as macrophages, dendritic cells, and T cells. This protein has been shown to bind to various carbohydrates, including mannose, fucose, and N-acetylglucosamine, which are commonly found on the surface of pathogens. This binding activity allows Recombinant Mouse CLEC11A Protein to recognize and interact with these pathogens, leading to the activation of immune responses.

Additionally, Recombinant Mouse CLEC11A Protein has been found to have a role in the regulation of cell growth and differentiation. It has been shown to bind to growth factors, such as TGF-β, and modulate their activity. This suggests that Recombinant Mouse CLEC11A Protein may have potential therapeutic applications in the treatment of certain diseases, such as cancer.

Application of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein has a wide range of applications in scientific research and biotechnology. One of its main uses is as an antigen in immunological studies. The C-type lectin domain of this protein is highly immunogenic, making it an ideal candidate for use as an antigen in the production of antibodies. These antibodies can then be used in various research techniques, such as Western blotting and immunohistochemistry, to study the expression and function of Recombinant Mouse CLEC11A Protein.

Moreover, Recombinant Mouse CLEC11A Protein has potential applications in drug development. Its ability to bind to growth factors and regulate cell growth and differentiation makes it a promising target for the development of therapeutics. It can also be used in the production of recombinant vaccines, as its carbohydrate-binding activity allows it to target and activate immune responses against specific pathogens.

Furthermore, Recombinant Mouse CLEC11A Protein has been used in the development of diagnostic tools for various diseases. Its expression in immune cells and its role in immune responses make it a potential biomarker for certain diseases. By detecting the levels of this protein, researchers can gain insights into the immune status of an individual and potentially diagnose diseases at an early stage.

Conclusion

In summary, Recombinant Mouse CLEC11A Protein is a versatile protein with a wide range of applications in scientific research and biotechnology. Its unique structure, binding activity, and role in immune responses make it a valuable tool for studying and understanding various biological processes. With ongoing research, this protein may also hold potential for therapeutic and diagnostic applications in the future.

Recombinant Mouse CLEC11A Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CLEC11A Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products