Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FGL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P12804
Molecular weight:
29.55 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
His200–Pro432
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FGL2 Protein, N-His

Product name ARO-P11120-100
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432
Product name ARO-P11120-1MG
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432
Product name ARO-P11120-50
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432

Introduction to Recombinant Mouse FGL2 Protein

Recombinant Mouse FGL2 Protein, also known as fibrinogen-like protein 2, is a type of recombinant protein that has been produced through genetic engineering techniques. This protein is derived from the mouse FGL2 gene and has been extensively studied for its structure, activity, and potential applications in various fields of research. In this article, we will delve into the details of Recombinant Mouse FGL2 Protein and its significance in the scientific community.

Structure of Recombinant Mouse FGL2 Protein

Recombinant Mouse FGL2 Protein is a glycoprotein that consists of 337 amino acids and has a molecular weight of approximately 38 kDa. It is composed of three distinct domains: an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain contains a signal peptide that is responsible for the secretion of the protein from the cell. The central domain is the largest and contains a highly conserved fibrinogen-like domain, which is responsible for the binding of the protein to fibrinogen and other ligands. The C-terminal domain is the smallest and contains a putative serine protease domain, which is believed to be involved in the proteolytic activity of FGL2.

Activity of Recombinant Mouse FGL2 Protein

Recombinant Mouse FGL2 Protein has been found to have various activities, including immunomodulatory, anticoagulant, and antiviral activities. The immunomodulatory activity of this protein is attributed to its ability to inhibit the activity of T cells and natural killer cells, thus suppressing the immune response. This activity has been studied extensively in the context of autoimmune diseases and organ transplantation, where FGL2 has been shown to play a crucial role in regulating immune tolerance. Additionally, Recombinant Mouse FGL2 Protein has been found to have anticoagulant activity by inhibiting the conversion of fibrinogen to fibrin, thereby preventing blood clot formation. This activity has been studied in the context of thrombotic disorders and has shown promising results in preclinical studies. Furthermore, FGL2 has been found to have antiviral activity by inhibiting the replication of certain viruses, including hepatitis C virus and human immunodeficiency virus (HIV).

Application of Recombinant Mouse FGL2 Protein

Recombinant Mouse FGL2 Protein has numerous potential applications in the fields of immunology, hematology, and virology. In immunology, this protein has been studied for its role in immune tolerance and has shown promising results in the treatment of autoimmune diseases and prevention of organ rejection in transplantation. In hematology, FGL2 has been studied for its anticoagulant activity and has shown potential as a therapeutic agent for thrombotic disorders. Moreover, Recombinant Mouse FGL2 Protein has been studied for its antiviral activity and has shown potential as a treatment for viral infections, particularly in the case of hepatitis C and HIV. Additionally, FGL2 has been studied in cancer research as it has been found to be overexpressed in certain types of cancer, and its inhibition has shown promising results in preclinical studies.

Conclusion

In conclusion, Recombinant Mouse FGL2 Protein is a glycoprotein with a complex structure and diverse activities. Its role in regulating immune tolerance, inhibiting blood clot formation, and suppressing viral replication has garnered significant interest in the scientific community. With its potential applications in various fields of research, Recombinant Mouse FGL2 Protein holds promise as a therapeutic agent for various diseases and disorders. Further studies and clinical trials are needed to fully understand the potential of this protein and its implications in the field of medicine.

Recombinant Mouse FGL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FGL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products