Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ctf2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P83714
Molecular weight:
21.69 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Ser26–Ala204
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ctf2 Protein, N-His

Product name ARO-P10567-100
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204
Product name ARO-P10567-1MG
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204
Product name ARO-P10567-50
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204

Recombinant Mouse Ctf2 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a particular protein is inserted into a host organism, such as bacteria, to produce large quantities of the desired protein. Recombinant proteins have become essential tools in various fields of science, including biotechnology, medicine, and research. One such recombinant protein is Recombinant Mouse Ctf2 Protein, which has gained significant attention due to its unique structure, activity, and potential applications.

Structure of Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein, also known as Chromatin Transcription Factor 2 (Ctf2), is a 68 kDa protein that belongs to the high mobility group (HMG) family of proteins. It is composed of 595 amino acids and contains a single HMG box domain, which is responsible for its DNA binding activity. The HMG box domain of Ctf2 is highly conserved among species and plays a crucial role in its function. In addition, Ctf2 also contains a nuclear localization signal (NLS) that allows it to enter the nucleus and bind to DNA.

Activity of Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein is primarily known for its role in regulating gene expression. It acts as a transcription factor, binding to specific DNA sequences and promoting the transcription of nearby genes. Ctf2 has been shown to interact with other proteins involved in transcription, such as RNA polymerase II, to enhance its activity. In addition, Ctf2 has also been found to play a role in DNA repair and maintenance of genome stability.

Applications of Recombinant Mouse Ctf2 Protein

The unique structure and activity of Recombinant Mouse Ctf2 Protein make it a valuable tool in various applications. One of its main applications is in the field of gene regulation studies. Ctf2 can be used to study the effects of its binding on gene expression and identify potential target genes. This information can be crucial in understanding the role of Ctf2 in various biological processes and diseases.

Moreover, Recombinant Mouse Ctf2 Protein has also been used in the development of diagnostic tools for certain diseases. For example, it has been shown to be a potential biomarker for breast cancer, with higher levels of Ctf2 expression observed in breast cancer tissues compared to normal tissues. This makes Ctf2 a potential target for early detection and monitoring of breast cancer.

Furthermore, Ctf2 has also been investigated as a potential therapeutic target for cancer treatment. It has been found to be overexpressed in certain types of cancer, and targeting Ctf2 could potentially inhibit tumor growth and progression. Recombinant Mouse Ctf2 Protein can also be used in drug discovery and development, as it plays a crucial role in the transcription of genes involved in various diseases.

Conclusion

In conclusion, Recombinant Mouse Ctf2 Protein is a unique recombinant protein with a specific structure and activity that make it a valuable tool in various scientific applications. Its role in gene regulation, DNA repair, and potential applications in disease diagnosis and treatment make it a promising candidate for further research and development. With the advancement of genetic engineering techniques, the production of Recombinant Mouse Ctf2 Protein has become more efficient and cost-effective, making it more accessible for scientific use.

Recombinant Mouse Ctf2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse Ctf2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products