Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse NRTN Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P97463
Molecular weight:
23.64 kDa

Original price was: €362.00.Current price is: €329.00.

100ug 9% OFF + 329 loyalty points
Arg99–Val195
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse NRTN Protein, N-His-SUMO

Product name ARO-P10568-100
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195
Product name ARO-P10568-1MG
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195
Product name ARO-P10568-50
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195

Introduction to Recombinant Mouse NRTN Protein

Recombinant Mouse NRTN Protein is a highly purified and biologically active protein that belongs to the neurotrophic factor family. It is produced through recombinant DNA technology, where the gene responsible for the production of this protein is inserted into a host cell, typically a bacterial or mammalian cell, to produce large quantities of the protein.

Structure of Recombinant Mouse NRTN Protein

Recombinant Mouse NRTN Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit is made up of 134 amino acids and has a molecular weight of approximately 15 kDa. The protein has a conserved cysteine-rich domain, which is essential for its biological activity. This domain is responsible for the formation of disulfide bonds, which are crucial for the stability and function of the protein.

Activity of Recombinant Mouse NRTN Protein

Recombinant Mouse NRTN Protein is a potent neurotrophic factor that acts on a specific group of neurons in the central and peripheral nervous systems. It exerts its effects by binding to a specific receptor, known as the glial cell line-derived neurotrophic factor receptor alpha 2 (GFRα2). This receptor is highly expressed in the dopaminergic and motor neurons, making Recombinant Mouse NRTN Protein a critical factor in the development, maintenance, and survival of these neurons.

The binding of Recombinant Mouse NRTN Protein to GFRα2 leads to the activation of downstream signaling pathways, including the PI3K/AKT and MEK/ERK pathways. These pathways are involved in cell survival, proliferation, and differentiation, which are essential for the proper functioning of the nervous system.

Application of Recombinant Mouse NRTN Protein

Recombinant Mouse NRTN Protein has a wide range of applications in both research and clinical settings. Its neurotrophic properties make it a valuable tool for studying the development and function of the nervous system. It has been used in various in vitro and in vivo studies to investigate the role of neurotrophic factors in neuronal survival, differentiation, and regeneration.

In clinical settings, Recombinant Mouse NRTN Protein has shown promising results in the treatment of neurodegenerative diseases, such as Parkinson’s disease. It has been shown to protect dopaminergic neurons from degeneration and promote their survival, making it a potential therapeutic option for this debilitating disease.

Moreover, Recombinant Mouse NRTN Protein has also been studied for its potential role in nerve regeneration and repair. It has been shown to promote axonal growth and regeneration in animal models of nerve injury, making it a potential candidate for the treatment of nerve damage and paralysis.

Conclusion

In summary, Recombinant Mouse NRTN Protein is a biologically active and potent neurotrophic factor that plays a crucial role in the development and maintenance of the nervous system. Its unique structure and activity make it a valuable tool for studying the nervous system and a potential therapeutic option for neurodegenerative diseases and nerve injuries. Further research and clinical trials are needed to fully understand the potential of Recombinant Mouse NRTN Protein and its applications in the field of neuroscience.

Recombinant Mouse NRTN Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse NRTN Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products