Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O35608
Molecular weight:
26.47 kDa

Original price was: €290.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Asp283–Phe496
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

Product name ARO-P11113-100
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496
Product name ARO-P11113-1MG
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496
Product name ARO-P11113-50
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496

Structure of Recombinant Mouse ANGPT2/Ang2 Protein

Recombinant Mouse ANGPT2/Ang2 Protein is a type of recombinant protein that is derived from the Angiopoietin-2 (Ang2) gene found in mice. It is a 60 kDa glycoprotein that is composed of 496 amino acids. The protein has a signal peptide at the N-terminus, a coiled-coil domain, and a C-terminal fibrinogen-like domain. The recombinant protein is produced by inserting the Ang2 gene into a suitable expression vector and then expressing it in a host organism such as E. coli or mammalian cells.

Activity of Recombinant Mouse ANGPT2/Ang2 Protein

Recombinant Mouse ANGPT2/Ang2 Protein plays a crucial role in regulating angiogenesis, the process by which new blood vessels are formed from pre-existing ones. It acts as a ligand for the Tie2 receptor, which is expressed on the surface of endothelial cells, smooth muscle cells, and hematopoietic stem cells. The binding of Ang2 to Tie2 leads to the activation of downstream signaling pathways that promote angiogenesis.

In addition to its pro-angiogenic activity, Recombinant Mouse ANGPT2/Ang2 Protein also has anti-apoptotic and anti-inflammatory effects on endothelial cells. It can protect endothelial cells from apoptosis induced by various stimuli, such as oxidative stress and TNF-α. Moreover, it can inhibit the production of pro-inflammatory cytokines and adhesion molecules, thereby reducing inflammation in the vasculature.

Application of Recombinant Mouse ANGPT2/Ang2 Protein

Recombinant Mouse ANGPT2/Ang2 Protein has a wide range of applications in both research and clinical settings. Its pro-angiogenic activity makes it a valuable tool for studying the mechanisms of angiogenesis and for developing new therapies for diseases that involve abnormal blood vessel formation, such as cancer and cardiovascular diseases.

One of the most important applications of Recombinant Mouse ANGPT2/Ang2 Protein is in the field of cancer research. It has been shown to promote tumor growth and metastasis by stimulating the formation of new blood vessels. Therefore, targeting Ang2 with specific inhibitors or antibodies has emerged as a potential strategy for inhibiting tumor growth and metastasis.

In addition to cancer, Recombinant Mouse ANGPT2/Ang2 Protein has also been implicated in various other diseases. For instance, it has been shown to play a role in the development of diabetic retinopathy, a common complication of diabetes that involves abnormal blood vessel growth in the retina. In this context, targeting Ang2 with specific inhibitors may have therapeutic potential for treating diabetic retinopathy.

Furthermore, Recombinant Mouse ANGPT2/Ang2 Protein has been studied as a potential therapeutic for cardiovascular diseases, such as atherosclerosis and ischemic heart disease. Its ability to promote angiogenesis and inhibit inflammation makes it a promising candidate for promoting the repair of damaged blood vessels and improving blood flow in these conditions.

In conclusion, Recombinant Mouse ANGPT2/Ang2 Protein is a versatile and important tool in the field of angiogenesis research. Its structure, activity, and various applications make it a valuable protein for understanding the mechanisms of angiogenesis and developing new treatments for diseases involving abnormal blood vessel formation. Continued research on this protein will help to further elucidate its role in various diseases and may lead to the development of novel therapies.

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ANGPT2/Ang2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products