Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse APOE Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P08226
Molecular weight:
23.31 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Gly20–Gln200
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse APOE Protein, N-His

Product name ARO-P10609-100
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200
Product name ARO-P10609-1MG
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200
Product name ARO-P10609-50
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200

Introduction

Recombinant proteins have become an essential tool in various fields of research and biotechnology. These proteins are produced by genetically engineering organisms, such as bacteria or yeasts, to express specific genes and produce large quantities of a desired protein. One such recombinant protein is the Recombinant Mouse APOE Protein, which has gained significant attention due to its important role in lipid metabolism and its potential therapeutic applications.

Structure of Recombinant Mouse APOE Protein

The Recombinant Mouse APOE Protein is a 299 amino acid long protein with a molecular weight of approximately 34 kDa. It belongs to the apolipoprotein family and is primarily produced in the liver. The protein is composed of two domains, N-terminal and C-terminal, which are connected by a flexible hinge region. The N-terminal domain contains the lipid-binding region, while the C-terminal domain is responsible for receptor binding and lipid transport. The protein also has a signal peptide sequence at its N-terminus, which is important for its secretion from the cell.

Activity of Recombinant Mouse APOE Protein

The main function of the Recombinant Mouse APOE Protein is to transport lipids, such as cholesterol and triglycerides, in the blood. It binds to lipoprotein particles and acts as a ligand for lipoprotein receptors, facilitating the uptake of lipoproteins by cells. This process is crucial for maintaining normal lipid levels in the body and preventing the development of cardiovascular diseases. Additionally, the protein also plays a role in the clearance of amyloid-beta, a protein associated with Alzheimer’s disease, from the brain.

Studies have shown that the activity of the Recombinant Mouse APOE Protein is dependent on its isoform. There are three isoforms of APOE in mice, APOE2, APOE3, and APOE4, with APOE3 being the most common. APOE4 has been associated with an increased risk of developing Alzheimer’s disease, while APOE2 has been shown to have a protective effect. Recombinant Mouse APOE Protein isoforms can be easily produced in large quantities, making it an important tool for studying the functional differences between these isoforms.

Application of Recombinant Mouse APOE Protein

The Recombinant Mouse APOE Protein has a wide range of applications in both research and therapeutic settings. In research, it is used to study the role of APOE in lipid metabolism and its association with diseases such as Alzheimer’s and atherosclerosis. The protein is also used in drug discovery and development, as it can be used to screen potential drugs that target APOE or its receptors.

In the field of therapeutics, Recombinant Mouse APOE Protein has shown promising results in the treatment of various diseases. Studies have shown that the protein can improve lipid metabolism and reduce atherosclerotic plaque formation in animal models. It has also been investigated as a potential treatment for Alzheimer’s disease, as it has been shown to enhance the clearance of amyloid-beta from the brain. Furthermore, the protein has been used as a carrier for drug delivery, as it can bind to lipoprotein receptors present on the surface of cells, allowing targeted delivery of drugs to specific tissues.

Conclusion

The Recombinant Mouse APOE Protein is a versatile and important tool in the field of research and therapeutics. Its well-defined structure, specific activity, and various applications make it an ideal candidate for studying lipid metabolism and developing treatments for diseases such as Alzheimer’s and atherosclerosis. With ongoing research and advancements in recombinant protein technology, the potential of Recombinant Mouse APOE Protein in various fields continues to expand.

</html

Recombinant Mouse APOE Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse APOE Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products