Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD244 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q07763
Molecular weight:
23.66 kDa

Original price was: €290.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Asp24–Thr212
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD244 Protein, N-His

Product name ARO-P10561-100
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212
Product name ARO-P10561-1MG
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212
Product name ARO-P10561-50
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212

Introduction

Recombinant Mouse CD244 Protein is a type of protein that is produced through the process of genetic engineering. It is a highly purified form of the mouse CD244 protein, which is a cell surface receptor found on immune cells. This protein has been extensively studied and has been found to play a crucial role in regulating the immune response. In this article, we will delve into the structure, activity, and applications of recombinant mouse CD244 protein.

Structure of Recombinant Mouse CD244 Protein

The recombinant mouse CD244 protein is composed of 376 amino acids and has a molecular weight of approximately 42 kDa. It is a type I transmembrane protein, which means that it spans the cell membrane and has a portion on the inside and outside of the cell. The protein has a single extracellular domain, a transmembrane domain, and a short intracellular domain.

The extracellular domain of recombinant mouse CD244 protein contains two immunoglobulin-like domains, IgV and IgC, which are responsible for binding to its ligand. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is involved in signal transduction.

Activity of Recombinant Mouse CD244 Protein

The main function of recombinant mouse CD244 protein is to regulate the activity of immune cells. It is primarily expressed on natural killer (NK) cells, a type of immune cell that plays a crucial role in fighting against infections and cancer. CD244 protein acts as a co-stimulatory molecule, which means that it enhances the activity of NK cells when they encounter their target cells.

When CD244 protein binds to its ligand, it triggers a signaling cascade that leads to the activation of NK cells. This activation results in the release of cytotoxic granules, which can kill infected or cancerous cells. CD244 protein also plays a role in modulating the production of cytokines, which are signaling molecules that regulate the immune response.

Applications of Recombinant Mouse CD244 Protein

The unique structure and activity of recombinant mouse CD244 protein make it a valuable tool for various applications in the field of immunology. One of its primary uses is in the study of NK cell biology. Researchers can use recombinant CD244 protein to investigate the role of this protein in regulating NK cell activity and its interaction with other immune cells.

Recombinant mouse CD244 protein is also used in the development of immunotherapies for cancer. By targeting CD244 protein on NK cells, scientists can enhance their activity and potentially improve their ability to fight against tumors. This approach has shown promising results in preclinical studies and is currently being tested in clinical trials.

Furthermore, recombinant mouse CD244 protein is also used in the development of diagnostic tools for immune-related disorders. By detecting the expression levels of CD244 protein on immune cells, researchers can gain insights into the immune response and identify potential biomarkers for diseases.

Conclusion

Recombinant Mouse CD244 Protein is a valuable tool in the field of immunology, with its unique structure and activity. Its role in regulating the immune response, particularly in NK cells, makes it a crucial protein for studying immune-related disorders and developing new therapies. As research continues to uncover the intricate functions of CD244 protein, its potential for clinical applications will only continue to grow.

Keywords

Recombinant protein, antigen, CD244, immune cells, NK cells, co-stimulatory molecule, cytokines, immunotherapy, diagnostic tools.

Recombinant Mouse CD244 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD244 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products