Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VIRMA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q69YN4
Molecular weight:
16.77 kDa

Original price was: €330.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Met1–Arg130
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VIRMA Protein, N-His

Product name ARO-P12171-100
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130
Product name ARO-P12171-1MG
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130
Product name ARO-P12171-50
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130

Introduction

The use of recombinant proteins in various fields of research and medicine has greatly advanced our understanding and treatment of various diseases. One such protein is Recombinant Human VIRMA Protein, which has gained significant attention in recent years due to its unique structure and diverse range of activities. In this article, we will delve into the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human VIRMA Protein

Recombinant Human VIRMA Protein, also known as Vir-like m6A methyltransferase-associated protein, is a 1,318 amino acid protein encoded by the VIRMA gene. This protein belongs to the RNA methyltransferase superfamily and contains several conserved domains, including the methyltransferase domain and the SPOUT domain. The methyltransferase domain is responsible for the catalytic activity of the protein, while the SPOUT domain plays a crucial role in substrate recognition and binding.

Furthermore, Recombinant Human VIRMA Protein also contains several other domains, such as the zinc finger domains, Tudor domain, and the PWWP domain. These domains are essential for the protein’s interaction with other proteins and its involvement in various cellular processes.

Activity of Recombinant Human VIRMA Protein

The primary function of Recombinant Human VIRMA Protein is to act as an m6A methyltransferase, which is involved in the methylation of adenosine residues in RNA molecules. This modification plays a crucial role in regulating various cellular processes, including RNA stability, translation, and splicing.

Moreover, Recombinant Human VIRMA Protein has been found to interact with other proteins, such as METTL3 and METTL14, to form the m6A methyltransferase complex. This complex is responsible for the methylation of specific RNA molecules, including messenger RNA (mRNA), ribosomal RNA (rRNA), and transfer RNA (tRNA).

Recent studies have also shown that Recombinant Human VIRMA Protein is involved in the regulation of gene expression and plays a crucial role in the development and differentiation of various cell types, including embryonic stem cells and immune cells.

Applications of Recombinant Human VIRMA Protein

The unique structure and activity of Recombinant Human VIRMA Protein have made it a valuable tool in various research areas, including epigenetics, RNA biology, and development. One of the primary applications of this protein is in the study of m6A RNA methylation and its role in regulating gene expression and cellular processes.

Moreover, Recombinant Human VIRMA Protein has also been used in the development of novel therapeutics for various diseases. For instance, recent studies have shown that the dysregulation of m6A RNA methylation is associated with various types of cancer. Therefore, targeting Recombinant Human VIRMA Protein and other components of the m6A methyltransferase complex could be a potential therapeutic strategy for cancer treatment.

Furthermore, Recombinant Human VIRMA Protein has also been used in the development of diagnostic tools for various diseases. For example, the detection of m6A RNA methylation levels in specific RNA molecules, such as mRNA, has been used as a biomarker for various diseases, including cancer and neurological disorders.

Conclusion

In conclusion, Recombinant Human VIRMA Protein is a crucial player in the regulation of RNA methylation and gene expression. Its unique structure and diverse range of activities make it a valuable tool in various research areas and a potential target for therapeutic interventions. Further studies on this protein and its role in various diseases could lead to the development of novel treatments and diagnostic tools in the future.

Recombinant Human VIRMA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VIRMA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products