Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NPHS2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP85
Molecular weight:
18.78 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Met222–Pro372
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NPHS2, N-His

Product name ARO-P13080-100
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372
Product name ARO-P13080-1MG
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372
Product name ARO-P13080-50
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372

Recombinant Human NPHS2: Structure, Activity, and Application

Introduction

Recombinant human NPHS2, also known as podocin, is a protein that plays a crucial role in maintaining the structure and function of the kidney filtration barrier. It is a transmembrane protein that is primarily expressed in the podocytes, specialized cells in the glomerulus of the kidney responsible for filtering blood. Mutations in the NPHS2 gene have been linked to the development of nephrotic syndrome, a rare kidney disorder characterized by excessive protein loss in the urine.

Structure of Recombinant Human NPHS2

The NPHS2 gene is located on chromosome 1 and encodes for a protein of 383 amino acids. The protein consists of three domains: an N-terminal domain, a transmembrane domain, and a C-terminal domain. The N-terminal domain contains a coiled-coil region that is essential for the formation of protein complexes. The transmembrane domain anchors the protein to the cell membrane, while the C-terminal domain interacts with other proteins involved in maintaining the structure of the kidney filtration barrier.

Activity of Recombinant Human NPHS2

Recombinant human NPHS2 has been extensively studied for its role in the development and maintenance of the kidney filtration barrier. It is a key component of the protein complex known as the slit diaphragm, which is responsible for regulating the passage of molecules through the filtration barrier. Studies have shown that mutations in the NPHS2 gene disrupt the function of the slit diaphragm, leading to increased permeability and protein loss in the urine.

Furthermore, NPHS2 has been shown to interact with other proteins, such as nephrin and CD2AP, to form a tripartite complex that is crucial for maintaining the structural integrity of the slit diaphragm. This complex also plays a role in signaling pathways that regulate the function of podocytes and the filtration barrier.

Application of Recombinant Human NPHS2

Recombinant human NPHS2 has various applications in both research and clinical settings. One of the main applications is in the study of nephrotic syndrome and other kidney disorders. By studying the structure and function of NPHS2, researchers can gain a better understanding of the underlying mechanisms of these diseases and potentially develop new treatments.

Additionally, recombinant human NPHS2 can be used as an antigen in diagnostic tests for nephrotic syndrome. Antibodies against NPHS2 can be used to detect mutations in the gene and aid in the diagnosis of the disease. This can also be useful in genetic counseling for families with a history of nephrotic syndrome.

In the future, recombinant human NPHS2 may also have therapeutic applications. As our understanding of the protein and its role in kidney function continues to grow, it may be possible to develop targeted therapies to treat kidney disorders associated with NPHS2 mutations.

Conclusion

In summary, recombinant human NPHS2 is a key protein involved in maintaining the structure and function of the kidney filtration barrier. Its structure, activity, and application have been extensively studied and have provided valuable insights into the development and treatment of kidney disorders. Further research on NPHS2 may lead to new therapeutic options for patients with nephrotic syndrome and other related conditions.

Recombinant Human NPHS2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NPHS2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products