Brand: ProteoGenix

Recombinant Human CD266/TNFRSF12A, N-GST

ARO-P13083-100
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: Q9NP84
Molecular weight:: 37.72 kDa

Original price was: €349.00.Current price is: €275.00.

100ug 21% OFF + 275 loyalty points

Ser24–Ala126

Size Size

50ug Original price was: €241.00.Current price is: €193.00.
100ug Original price was: €349.00.Current price is: €275.00.
1MG Original price was: €878.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human CD266/TNFRSF12A, N-GST

Product name	ARO-P13083-100
Uniprot ID	Q9NP84
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVA
Molecular weight	37.72 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser24-Ala126
Aliases /Synonyms	FGF-inducible 14, TNFRSF12A, FN14, CD266, TweakR, Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, Tumor necrosis factor receptor superfamily member 12A
Reference	ARO-P13083
Note	For research use only.
Molecular Constructor	Ser24–Ala126

Product name	ARO-P13083-1MG
Uniprot ID	Q9NP84
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVA
Molecular weight	37.72 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser24-Ala126
Aliases /Synonyms	FGF-inducible 14, TNFRSF12A, FN14, CD266, TweakR, Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, Tumor necrosis factor receptor superfamily member 12A
Reference	ARO-P13083
Note	For research use only.
Molecular Constructor	Ser24–Ala126

Product name	ARO-P13083-50
Uniprot ID	Q9NP84
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVA
Molecular weight	37.72 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser24-Ala126
Aliases /Synonyms	FGF-inducible 14, TNFRSF12A, FN14, CD266, TweakR, Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, Tumor necrosis factor receptor superfamily member 12A
Reference	ARO-P13083
Note	For research use only.
Molecular Constructor	Ser24–Ala126